KEGG   Aeromonas sp. CU5: CK911_02620Help
Entry
CK911_02620       CDS       T05327                                 

Definition
(GenBank) two-component system response regulator ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
aem  Aeromonas sp. CU5
Pathway
aem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CK911_02620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aem02022]
    CK911_02620
Two-component system [BR:aem02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   CK911_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ATL91812
UniProt: A0A291TF79
LinkDB All DBs
Position
complement(575684..576403)
Genome map
AA seq 239 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYAVLEANNGDEMHQALTSHTINLVIMDINLPGK
NGLLLARELRENDNIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNVAAGGEEKKLVERYLFNSWALDINSRALVSPTGDMFKLPRSEFRAMLHFCENPGQIQ
TRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESVNDTPEIIATIHGEGYRFCGELEQE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaccacacattctgatcgtcgaagacgaactggtcacacgcaataccctgaaa
agcattttcgaagcagaaggctacgcggttcttgaagccaataatggcgatgagatgcat
caagctctcacctcccacaccatcaatctggtgatcatggacatcaacctgccaggcaag
aatggcctgctgctggctcgtgagctgcgtgaaaacgacaacatcgctctgatgttcctg
accggtcgcgacaacgaagtggataaaattctgggcctggagatcggcgcagatgattac
atcaccaagccgttcaacccccgcgagctgaccatccgtgcccgtaacctgctgagccgc
accatgaacgtggcagccggtggcgaagagaagaagctggttgagcgttacctgttcaac
agctgggcgctggatatcaatagccgcgcactggtcagcccgactggcgacatgttcaag
ctgccgcgctccgagttccgcgccatgctgcacttctgcgaaaacccgggccagatccag
acccgtgctgaactgctcaaaaagatgacaggtcgtgagctcaagccccatgatcgtact
gtcgatgtgaccatccgtcgcattcgcaagcacttcgaaagcgtcaatgacaccccggag
atcatcgccaccatccacggcgaaggctaccgtttctgtggtgagctggagcaggaataa

DBGET integrated database retrieval system