KEGG   Aeromonas sp. CU5: CK911_03235Help
Entry
CK911_03235       CDS       T05327                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00220  Arginine biosynthesis
aem00250  Alanine, aspartate and glutamate metabolism
aem00290  Valine, leucine and isoleucine biosynthesis
aem01100  Metabolic pathways
aem01110  Biosynthesis of secondary metabolites
aem01130  Biosynthesis of antibiotics
aem01210  2-Oxocarboxylic acid metabolism
aem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aem00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CK911_03235
   00290 Valine, leucine and isoleucine biosynthesis
    CK911_03235
   00220 Arginine biosynthesis
    CK911_03235
Enzymes [BR:aem01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CK911_03235
    2.6.1.66  valine---pyruvate transaminase
     CK911_03235
Amino acid related enzymes [BR:aem01007]
 Aminotransferase (transaminase)
  Class I
   CK911_03235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATL91920
UniProt: A0A291TFS4
LinkDB All DBs
Position
complement(693907..695121)
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTCGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVLTGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRKQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctacgacatccgcggcccg
gtgcataaagaagcccgccgtctcgaagacgaaggccaccgcattctcaagctcaacatc
ggcaacccggccccgtttggttttgatgccccggaagagatcatcaaggatgtgatcctc
aacatgccgctgagtcagggctactgcgattccaaggggctgttttctgcccgcaaggcg
gtgatgcagtactaccagcaaaaagggatgcgcaaggtcgatatcgacgacatctatatc
ggcaatggtgccagcgagctgatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactacccgctctggactgccgccgtcaccctctccggt
ggccatgcggtgcactaccgctgtgacgaaggggctgactggtatccggatctcgacgac
atccgcgcccgcatcaccccgcgtacctgcggcctggtactgatcaaccccaacaacccg
accggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcattttcgccgacgagatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgtgacgatgtgatggtagtgaccttcaacggcctctccaaa
gcctaccgtgcctgtggcttccgtcagggctggatggtcctcaccggccccaagggccgt
gccaaaggctacatcgaggggctggagatgctggcctccatgcggctgtgtgccaacgtg
ccaatgcagcacgccatccagaccgcgctcggcggttaccagagcatcaacgagctgatc
ctgccgggcggtcgcctgcgcaagcagcgggacaaggcgtgggagctgctcaacgacatt
ccgggggtctcctgcgtcaaacccaagggggcgctctacatgttcccgcgcctcgatccc
aaggtgtatgacattcgcgacgaccagaagatggtgttcgatctgctgcagcaagagaaa
ctgctgctggtgcagggcaccggcttcaactggccggcaccggatcacttccgattggtg
tttctgccccgcgaagaggagctggaagaggccattggccgcctcgcccgcttcctcaag
ggttacaagcagtaa

DBGET integrated database retrieval system