KEGG   Aeromonas sp. CU5: CK911_05795Help
Entry
CK911_05795       CDS       T05327                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00020  Citrate cycle (TCA cycle)
aem00190  Oxidative phosphorylation
aem00650  Butanoate metabolism
aem01100  Metabolic pathways
aem01110  Biosynthesis of secondary metabolites
aem01120  Microbial metabolism in diverse environments
aem01130  Biosynthesis of antibiotics
aem01200  Carbon metabolism
Module
aem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aem_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CK911_05795
   00650 Butanoate metabolism
    CK911_05795
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CK911_05795
Enzymes [BR:aem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CK911_05795
    1.3.5.4  fumarate reductase (quinol)
     CK911_05795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ATL92377
UniProt: A0A291TGR5
LinkDB All DBs
Position
1286128..1287894
Genome map
AA seq 588 aa AA seqDB search
MTIPTREFDAVVIGAGGAGMRAALSIAQSGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HDDNWQWHMYDTVKGSDYIGDQEAIEYMCKTGPEAIYELENMGLPFSRFENGSVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNVKSKTTVFSEWYALDLVKNQDGHIVGC
TAIDMESGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVGVQDMEFWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPIIPTCHYMMGGV
PTNVNGQCLAQDKDGNDVPVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMYLV
NTLGEMEHGREASESDIDAAMARFNRWENCRDGEDPVQIRKDLQTCMQNNFSVFREGDAM
AEGLAELKLIRERLKRARLDDTSKEFNTQRIECLELDNLMETAFATAVAANFRTESRGAH
SRFDFPDRDDESWLCHSLYHPDSESMTRRAVNMSPKTREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccaactcgtgaatttgatgctgtggtgattggtgccggtggtgccggtatg
cgcgccgcgctctcgattgcccagtccggcaagagctgcgctctgttgtccaaggtcttt
ccaacccgttcccacacggtttccgctcagggcgggatcacggttgcgctgggcaatgcc
cacgacgacaactggcagtggcacatgtatgacaccgtcaaaggctccgactatatcggt
gaccaggaggccatcgagtacatgtgcaagacgggccccgaggccatctacgagctggag
aacatgggcctgcccttctcccgctttgaaaacggttctgtctaccagcgtccgtttggt
ggtcagtccaagaattttggtggtgagcaggctgctcgcaccgcggcggccgctgaccgt
accggtcacgccctgctgcacaccctttatcagcagaacgtcaagagcaagaccactgtc
ttctccgagtggtatgcgctggatctggtgaagaaccaggacggtcacatcgttggctgt
accgccatcgatatggagagcggcgaagtggtctacttcaaggccaaggcgaccgtgctg
gccactggcggtgccggtcgtatctaccagtccaccaccaatgcccacatcaacaccggc
gacggtgtcggcatggcgttgcgcgccggggtaggggtgcaggacatggagttctggcag
ttccacccgaccggcatcgccggggcaggggtattggtgaccgaagggtgccgtggtgaa
ggcggttatctgcttaacaaagatggcgagcgcttcatggagcgttacgcccccaacgcc
aaggatctggccggtcgcgacgtggtggcccgctccatcatgatcgagatccgcgaaggc
cgtggttgtgacggcccctggggcccgcacatcaagctcaagctggatcacctcggcaaa
gaggtgctggaatcccgtctgccgggtatctgcgagctgtcgcgcaccttcgcccacgtg
gatccggtcaaagaacctattccgatcatcccgacctgccactacatgatgggcggcgtg
ccgaccaacgtgaatggccagtgtctggcacaagacaaagatggcaatgacgtacctgtg
gtcggcctgtttgcggtgggcgagattgcctgcgtttctgtgcacggcgccaaccgcctg
ggtggtaactccttgctggatctggtggtgttcggtcgtgccgctggcatgtatctggtc
aacaccctgggcgagatggagcacggccgcgaagcgtcagagtccgacatcgacgccgct
atggcccgcttcaaccgctgggaaaattgccgtgacggcgaagacccggtgcagatccgc
aaggacctgcagacctgcatgcagaataacttctcggtgttccgtgaaggtgatgccatg
gcagaagggctggccgagctgaaactcattcgcgagcgcctcaagcgtgcccggctggat
gacacctccaaggagttcaacacccagcgcatcgagtgcctggagctggacaacctgatg
gagacggcgtttgccaccgcggtggcggccaacttccgtaccgagagtcgcggtgcgcat
agccgctttgacttcccggatcgggacgacgagagctggttgtgccacagcctctatcat
ccggactccgagtccatgacccgtcgcgcggtcaacatgtctccgaaaacccgtgaagcg
ttcccacccaaggtgcggacttactga

DBGET integrated database retrieval system