KEGG   Aeromonas sp. CU5: CK911_05845
Entry
CK911_05845       CDS       T05327                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00260  Glycine, serine and threonine metabolism
aem00261  Monobactam biosynthesis
aem00270  Cysteine and methionine metabolism
aem00300  Lysine biosynthesis
aem01100  Metabolic pathways
aem01110  Biosynthesis of secondary metabolites
aem01120  Microbial metabolism in diverse environments
aem01210  2-Oxocarboxylic acid metabolism
aem01230  Biosynthesis of amino acids
Module
aem_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
aem_M00017  Methionine biosynthesis, apartate => homoserine => methionine
aem_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CK911_05845 (asd)
   00270 Cysteine and methionine metabolism
    CK911_05845 (asd)
   00300 Lysine biosynthesis
    CK911_05845 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CK911_05845 (asd)
Enzymes [BR:aem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     CK911_05845 (asd)
SSDB
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Other DBs
NCBI-ProteinID: ATL92386
UniProt: A0A291TGW5
LinkDB
Position
complement(1300195..1301307)
AA seq 370 aa
MKKVGLVGWRGMVGSVLMSRMQEEQDFAHIQPTFFTTSQAGEAAPNFGVDAGTLQDAFDI
AALAKQDIIITAQGGDYTKDVYPRLKAAGWQGYWIDAASSLRMEKDAVIILDPVNGDVIE
QALNDGIKTFVGGNCTVSLMLLALGGLFKADLVEWVSVATYQAASGGGARHMRELVTQMG
MLRDEVAVELADPASAILDIERKITEKTRSGTLPVDNFGVPLAGGLIPWIDTKLDNGQSR
EEWKGQAETNKILGIENAVIPVDGLCVRIGALRCHSQAFTIKLKKDVPLAEIEALLAAHN
DWVKVIPNDRDITARELTPAAVTGTLSIPVGRLRKLNMGPEYLAAFTVGDQLLWGAAEPL
RRMLRILLAR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaaaaaagtaggtttggtcggttggcgtggcatggtgggatcggttctgatgagccgg
atgcaggaagagcaggatttcgcccatattcaacccacattcttcaccacctcccaggcc
ggtgaggccgcacccaactttggcgtcgatgccggtaccctgcaggacgccttcgatatc
gcggcgctggccaagcaggatatcatcatcaccgcccaaggcggcgactacaccaaggat
gtctatccgcgtctgaaagccgctggctggcagggttactggattgacgccgcctcctcc
ctgcggatggagaaagatgccgtcatcattctggatccggtcaacggcgacgtgatcgag
caagccctgaacgacggcatcaagaccttcgttggcggcaactgcaccgtcagcctgatg
ctgctggccctcggcggcctgttcaaggccgatctggtggagtgggtcagcgtggccacc
tatcaggcagcctccggtggcggtgcccgccatatgcgcgagctggtcacccagatgggc
atgctgcgcgatgaagtggcggtcgagctggccgatcctgcctccgccatcctcgacatc
gagcgcaagatcaccgagaagacccgctccggcaccctgccggtggacaacttcggcgtg
ccgctggccggtggcctcattccctggatcgacaccaagctcgacaacggccagagccgc
gaagagtggaagggtcaggccgagaccaacaagattttgggtatcgaaaacgccgtcatt
ccggtggatggtctctgtgtgcggatcggcgccctgcgctgccacagccaggccttcacc
atcaagctgaaaaaggatgtgccgctggcggagatcgaagcgctgctggctgcccacaac
gactgggtgaaagtgatccccaacgatcgcgacatcaccgcccgcgagctgactccggcg
gccgtcaccggcaccctcagcattccggtgggtcgtctgcgcaaactcaatatgggccct
gagtatctggccgcctttaccgtgggtgaccagctgctgtggggcgccgccgagccgctg
cgccgcatgctgcgtatcctgctggcgcgctaa

DBGET integrated database retrieval system