KEGG   Aeromonas sp. CU5: CK911_09730Help
Entry
CK911_09730       CDS       T05327                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00473  D-Alanine metabolism
aem01100  Metabolic pathways
aem01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK911_09730 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CK911_09730 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aem01011]
    CK911_09730 (alr)
Enzymes [BR:aem01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CK911_09730 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:aem01011]
 Precursor biosynthesis
  Racemase
   CK911_09730 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATL93056
UniProt: A0A291TIU0
LinkDB All DBs
Position
2232155..2233381
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLIFGLLAGQAIAAPYLPIATDHRNGQEQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKANIPCIGIASNEEARVAREKGFTGRLMRV
RAATPAEVEQALPYKMEELIGSLVSAQGIADIAQRHHTTIPVHVALNSAGMSRNGIDLRL
ADAKQDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLAVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYAAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKMPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcataagaaaacgctattggctaccctgatcttcggcctgctcgcgggccaagccatt
gcggctccctacctgcccattgcgacagatcatcgcaacggtcaggagcagaccgccagc
aacgcctggttagaagtggatctgggtgcctttgaacacaatatccagaccctcaaggat
cgcctcggcgacaagggcccgcagatctgcgccatcatgaaggccgacgcctatggtcat
ggcatcgacctgctggtcccctccgtggtcaaagccaatatcccctgcatcggcatcgcc
agcaacgaagaggcgcgcgtcgcccgcgagaagggctttaccggtcgtctgatgcgggtg
cgtgccgccaccccggccgaagtggaacaggccttgccctacaaaatggaagagctgatc
ggcagtctggtgagtgcccagggcatcgccgacatcgcccagcgccaccacaccactatt
ccggtgcatgtcgcgctcaactccgccggtatgagccgcaacggtatcgacctgcgtctg
gccgatgccaagcaggatgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatggggctggcccagttc
aaactggactcccagtggttgctggaagcgggcaagctggatcgcagcaagatcaccatc
catgccgccaactccttcgccaccctggccgtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctctacggcgactccatcccctcctacaccgaatacaagcgggtgatg
gcattcaagacccaggtcgcctcggtcaaccactatgcggcgggcaacaccgtcggctat
gaccgcacctttaccctcaagcgtgactcctggctcgccaacctgccgctgggttactcc
gatggctatcgccgtgcgctgagcaacaaagcttatgttctgatccagggtcagaagatg
ccggtggtcggaaagacctccatgaacaccatcatggtggatgtgaccgatctcaaaggg
gtgaaacccggcgatgaggtggtgctgtttggtcgtcagggtgaggccgaggtgaaacag
gcggatctggaggagtacaacggcgccctgctggcggatatgtacaccatctggggctac
accaaccccaagaagatcaaacgctga

DBGET integrated database retrieval system