KEGG   Aeromonas sp. CU5: CK911_14620Help
Entry
CK911_14620       CDS       T05327                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00620  Pyruvate metabolism
aem00680  Methane metabolism
aem01100  Metabolic pathways
aem01120  Microbial metabolism in diverse environments
aem01200  Carbon metabolism
Module
aem_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CK911_14620
  09102 Energy metabolism
   00680 Methane metabolism
    CK911_14620
Enzymes [BR:aem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CK911_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATL93911
UniProt: A0A291TLP5
LinkDB All DBs
Position
complement(3280743..3283376)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSSRKGNESDRERLLDTL
RTLSDSELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDPLEQMFDKLKASNLSQE
AIIAAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALELSDLLPRERDKILNRIEQ
LINQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMRNLDERLQHHLGVRLPLDA
APVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYKDIKELTSELSMSDCTDAVR
ARVGDHPEPYRALVRELREALRETKEHLTAKVQGQVSESQDLVKTTAQLREPLELCYHSL
HACGMGNIADGMLLDVLRKVACFGIHLVKLDIRQDGERHGLVFSELTRYLGMGDYAEWSE
DDKQAFLLNELNSRRPLIPHDWEPSAEVRETLDTCRVIAQYDPDAFGIYIISMAGAPSDV
LSVQLLLKEAGCKFRMPVAPLFETQDDLMAGTAVMERLLSVDWYRGYIQGRQYVMIGYSD
SAKDAGMMAAGWAQYAAMESLVGLAEANNIRLTLFHGRGGTVGRGGAPAHQAILSQPPGS
LRGGLRTTEQGEMIRFKFGLPKVAIKSLELYTSAVLEGNLLPPPKPKECWREVMEQLAAD
SCEHYRSIVRGHPDFVPYFRAATPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQ
NRLMLPAWLGAHKALQQAIDGDKLAVLEEMSAQWPFFRTRLEMLEMVFLKADAWLAEYYD
TRLVPQELWGLGKQLRQELADSIEVVLKLSPRGDLLEDQPWIKESIKLRNPYTDPLNVLQ
AELLNRSRNQSETLHPELDKALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagtacgccgcactacgcgccaacgtaggtatgctgggtcagctgctgggt
aaatccatcaaggatcatcagggtcaggcctttctcgacaagatcgaaaccattcgccaa
ttggccaagtcctcccgcaagggcaatgaatcagaccgggaacgtctgctcgataccctg
cgtaccctgagtgatagcgagctgctgccggtggcccgcgccttcagccagttcctcaat
ctggccaacgtggcggaacagttccacaccatctcccgtcgttgcgaagagcaggtctgc
accccggatccgctggagcagatgttcgacaaactgaaagcctccaacctgtcgcaagag
gccatcattgcggccgtgcgcgagctggatatcgatctggtgctgaccgctcaccccacc
gaggtgacccgtcgcaccctgatccacaagcacgtgcagctcaacgactgcctcgaggcg
ctggagctctctgacctgctgccccgcgagcgggacaagatcctcaatcgcatcgagcag
ctgatcaatcaggcgtggcacaccaacgagatccgcgaacagcgcccgactccggtggac
gaggccaagtggggcttcgctgtggtggagaacagcctgtggccggccatccccgaattc
atgcgcaatctggacgagcgtctgcaacaccatctgggtgtgcggttgccgctggatgcc
gcgccggtcaagttcacctcctggatgggcggtgaccgcgacggcaaccccttcgtcacc
gccaaggtgactgccgaagtgctggagctgggccgctggatggcggtgagcctgttctac
aaagacatcaaggagctcacctccgagctctccatgtccgactgtaccgacgccgtgcgc
gcccgggttggcgatcaccccgagccctaccgtgcgctggtgcgcgagctgcgtgaagcg
ctgcgcgaaaccaaagagcacctcaccgccaaggtgcagggtcaggtgagcgagagccag
gatctggtcaagaccaccgcccagctgcgcgagccgctggagctctgctaccactcattg
catgcctgcggcatgggcaacatcgccgacggcatgctgctggacgtgctgcgcaaggtc
gcctgtttcggcatccatctggtcaagctcgatatccgtcaggatggcgagcgccacggg
ctggtcttctccgagctgacccgctatctgggcatgggtgactacgccgagtggagcgaa
gatgacaagcaggccttcctgctcaatgagctcaactcccgccgtccgcttattccccac
gactgggagccgagcgccgaggtacgcgagaccctggatacctgccgggtcatcgcccag
tacgaccccgatgcctttggtatctacatcatctccatggccggtgcgccgtccgacgtg
ctgtcggtgcaactgctgctcaaagaggcgggctgcaagttccgcatgccggtcgccccg
ctgtttgaaactcaggatgacctgatggcaggcaccgccgtgatggagcgcctgctctcg
gtggactggtatcgcggttacattcagggccgccagtacgtgatgatcggctactccgac
tccgccaaggatgcgggcatgatggccgctggctgggcccagtacgccgccatggaatcc
ttggtggggctggccgaagccaacaatatccgcctcaccctgttccatggccgtggcggt
accgtcggtcgtggtggtgcgcctgcccatcaggccatcctctcccagccgccgggatcc
ctgcgcggtggtctgcgtaccaccgaacagggggagatgatccgcttcaagttcggcctg
ccgaaagtggcgatcaagagcctggagctctacaccagcgccgtgctggaagggaacctt
ttgccgccgcccaagccgaaagagtgctggcgcgaggtgatggaacagctggccgccgac
tcctgcgagcactaccgcagtatcgtgcgcggtcatccggacttcgtcccttacttccgt
gccgccaccccggagatggagcttggcaagctgccgctcggttcccgtccctccaagcgc
aaacccaacggtggtgtcgagagcctgcgcgccattccatggatcttcgcctggacccaa
aaccgcctgatgctgccagcctggctcggtgcccacaaggcgctgcaacaggccatcgac
ggtgacaagctggcggtgctggaagagatgagtgcccagtggcccttcttccgcactcgc
cttgagatgctggagatggtgttcctcaaagcggacgcttggctcgccgagtactacgac
acccgtctggtgccgcaggagctgtggggcttgggtaaacagctgcgccaggagctcgcc
gactccatcgaagtggtgctgaaactgagcccgcgcggggatctgctggaagatcagccg
tggatcaaggagtccatcaagctgcgcaacccctacaccgacccgctcaacgtgctgcag
gctgagctgctcaaccgctcccgtaaccaatcggagaccctgcaccccgagctggacaag
gcgctgatggtcaccatcgccggcattgcagcaggtatgcgcaacaccggttga

DBGET integrated database retrieval system