KEGG   Arsenophonus endosymbiont of Aleurodicus dispersus: ARADI_0558Help
Entry
ARADI_0558        CDS       T05672                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aen  Arsenophonus endosymbiont of Aleurodicus dispersus
Pathway
aen00061  Fatty acid biosynthesis
aen00780  Biotin metabolism
aen01100  Metabolic pathways
aen01130  Biosynthesis of antibiotics
aen01212  Fatty acid metabolism
Module
aen_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ARADI_0558 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ARADI_0558 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ARADI_0558 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aen01004]
    ARADI_0558 (fabI)
Enzymes [BR:aen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ARADI_0558 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ARADI_0558 (fabI)
Lipid biosynthesis proteins [BR:aen01004]
 Fatty acid synthase
  Component type
   ARADI_0558 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: VAY02445
UniProt: A0A3B1E9U5
LinkDB All DBs
Position
I:529636..530427
Genome map
AA seq 263 aa AA seqDB search
MGFMSSKRILITGLASKLSIAHGIAQAMHQQGAELAFSYQGDKLKSRVEKMAKNFGSNIV
LPCDVASDESITILFYELAKVWPKLDGFVHSIAYAPADQLDGDYIDVVTREGSRIAHDIS
SYSFVALAKSCRKMLNHNSALVTISYLGAERAIPNYNIMGLAKASLEANVRYMANAIGPE
AIRVNGISAGPIRTLAASGIKDFRKMLSHFESVTPIRRTVTTEDVGNCAAFLCSDLSAGV
TGEILHVDGGFSIAAMNELKFKK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggctttatgagtagcaagcgcattcttattactggtttagctagtaaactctctatt
gctcatggtattgcacaagcaatgcaccaacaaggtgctgaacttgccttcagttatcaa
ggagataaacttaaatctcgcgtagaaaagatggcaaaaaactttggctctaatattgtt
ctgccatgtgatgttgcttctgatgaaagtatcactatattattttatgaactagcaaaa
gtatggcctaaattagatggttttgtccattcaattgcttatgccccagcggatcaactt
gatggtgattatatagatgtagttacacgcgagggctcacgaattgctcacgatattagt
tcatatagctttgttgcgttagccaaatcctgtcgaaaaatgttaaatcataattcggcc
ctagttaccatcagttatttgggcgctgagcgagcgatacctaactataatataatggga
ttagcaaaagcttcccttgaagctaatgtccgttatatggccaatgcaattggccctgaa
gctattcgcgttaacggcatttcagccggccccatccgcactttggcggcatctggtatt
aaagattttcgtaaaatgctatcacattttgaatcagtaactccaattcgccgcacggtt
acaacagaagatgttggtaattgtgctgctttcctttgttctgatttatctgctggtgtt
acaggtgaaattttacatgttgatggtggcttcagtattgctgctatgaatgaacttaag
tttaaaaagtaa

DBGET integrated database retrieval system