KEGG   Aeromonas salmonicida O23A: O23A_p0137Help
Entry
O23A_p0137        CDS       T04990                                 

Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00061  Fatty acid biosynthesis
aeo00620  Pyruvate metabolism
aeo00640  Propanoate metabolism
aeo01100  Metabolic pathways
aeo01110  Biosynthesis of secondary metabolites
aeo01120  Microbial metabolism in diverse environments
aeo01130  Biosynthesis of antibiotics
aeo01200  Carbon metabolism
aeo01212  Fatty acid metabolism
Module
aeo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O23A_p0137
   00640 Propanoate metabolism
    O23A_p0137
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    O23A_p0137
Enzymes [BR:aeo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     O23A_p0137
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     O23A_p0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A DUF3182
Motif
Other DBs
NCBI-ProteinID: ARW80891
UniProt: A0A0W0BAU2
LinkDB All DBs
Position
complement(145377..146717)
Genome map
AA seq 446 aa AA seqDB search
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASGESY
LNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAI
EAMKKAGVPCVPGSDGPVDSDAKHNAAIAKRIGYPVIIKAAGGGGGRGMRVVRNEAELAA
AIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQILADGQGNALYLGERDCSMQRRHQKVV
EEAPAPGITEEMRKFIGERCVRACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMVTSVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAP
GGLGVRWDSHIYAGYKVPPYYDSMIGKLICYGENRDVAIARMRQALDELVVEGIKTNVSL
QKEIMKDENFQHGGTNIHYLHKKLGL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaaagtagtcatcgccaaccgcggtgaaattgccctgcggatcctgcgcgct
tgcaaagagctcgggatcaagacagtggccgttcactccaccgccgatcgggagctcaaa
catgtgctcctggccgacgaaaccatctgcatcggcaagcctgccagcggtgaatcctac
ctcaatgtgccggcgatcatagccgctgccgaggtaacgggtgccgttgccatccacccg
ggttacggcttcctctcggagaacgccgatttcgccgaagtggtcgaaaaatccggcttc
atcttcatcggcccgcgcgccgagaccattcgcctgatgggtgacaaggtctccgccatc
gaggcgatgaaaaaagcgggcgtaccttgcgtgcctggctctgacggcccggtcgacagc
gatgccaagcacaacgccgccatcgccaagcgcatcggttatccagtgatcatcaaggcc
gccggtggcggtggtggtcgcggcatgcgcgtggtgcgcaatgaagccgagctggctgcc
gccatcgccctgaccaaatccgaagcaggccagttcttcaagaacgacatggtctacatg
gagaagtacctggagaacccgcgccatatcgaaattcagatattggcagacggccagggc
aacgccctctatctgggcgagcgtgactgctccatgcagcgtcgccaccagaaagtggtc
gaagaagcaccggcaccgggcatcaccgaagagatgcgcaagttcatcggcgagcgctgc
gtacgcgcctgcatcgagatcggctaccgcggtgcggggaccttcgagttcctgtacgaa
aacggcgagttctatttcatcgagatgaacacccgtatccaggttgagcatccggtcacc
gagatggtcaccagcgtggatctgatcaaggagcaactgcgcatcgccgccggccagccc
ctgtcgatcacccagcaggacatccgcatccgtggccatgccatcgaatgccggatcaac
gccgaagacccggctactttcatgccgtctccgggcctgatccagcgcttccatgcgccg
ggtggtctgggcgtacgttgggattcccacatctacgccggttacaaggtaccgccttac
tacgactccatgatcggcaagctgatctgttacggcgagaaccgtgacgtcgccatcgcc
cgcatgcgtcaggcgctggacgagctggtggtagaagggatcaagaccaacgtctccctg
caaaaagagatcatgaaggacgaaaacttccagcacggtggtaccaatatccactacctg
cacaagaagctgggtctgtaa

DBGET integrated database retrieval system