KEGG   Aeromonas salmonicida O23A: O23A_p0594Help
Entry
O23A_p0594        CDS       T04990                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aeo  Aeromonas salmonicida O23A
Brite
Enzymes [BR:aeo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     O23A_p0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARW81341
UniProt: A0A091ABV1
LinkDB All DBs
Position
complement(622435..623019)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGNEPTGALADAINKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
TLVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgctctgccctacgcaatcaatgccctggaaccgcacatctcc
caggaaactctggaatatcatcacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccaggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggcggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggcaacgagccgaccggcgccctggctgatgccatcaacaaggcg
tttggctccttcgccgagttcaaggatgccttcaccaagtctgccatcggcaacttcggt
tccagctggacttggctggtgaagaaagccgacggctccctggccatcgtcaacacttcc
aacgccggttgcccgctgaccgaagccggtactacaccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaacattctgg
accctggtgaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system