KEGG   Aeromonas salmonicida O23A: O23A_p0992Help
Entry
O23A_p0992        CDS       T04990                                 

Definition
(GenBank) Arginine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00473  D-Alanine metabolism
aeo01100  Metabolic pathways
aeo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    O23A_p0992
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    O23A_p0992
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
    O23A_p0992
Enzymes [BR:aeo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     O23A_p0992
Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
 Precursor biosynthesis
  Racemase
   O23A_p0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARW81739
UniProt: A0A1Z1NM59
LinkDB All DBs
Position
complement(1037965..1039191)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLTAFEQNLQTLKT
RLGDKGPQICAIMKADAYGHGIDLLVPSVIKAEIPCIGIASNEEARVAREKGFSGRLMRV
RAATPIEVEQALPYKLEELVGSLVSAQGISDIALRHHTTIPVHVALNSAGMSRNGIDLRL
ADAKQDALAMLKLKGITPVGIMTHFPVEEKEDVKLGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLAVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYAAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccaccttgatcctgggcctgctggccggtcaagccgtc
gcagccccctatctgccgctggcaagcgatcatcgcaacggcgaagtacaaaccgccagc
aacgcctggctggaagtagacctgaccgcgtttgaacagaatctgcagaccctcaagacc
cgcctcggcgacaagggcccgcagatctgcgccatcatgaaggcggacgcctacggtcac
ggcatcgacctgctggttccctccgtcatcaaggccgagatcccctgtatcggcatcgcc
agcaacgaagaggcccgcgtggcgcgcgagaaggggttcagcggccgcctgatgcgggtg
cgtgccgccacacctatcgaagtggaacaggccctgccctacaagctggaagagctggtt
ggcagcctggtgagtgctcaggggatctccgacatcgccctgcgccaccacaccaccatt
ccggtgcatgtcgccctcaactccgccggtatgagccgcaatggcatcgacctgcgtctg
gccgatgccaagcaagatgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagctggggctggcccagttc
aagctggactcccagtggctgctggaagcaggcaagctggatcgcagcaagatcaccatc
catgccgccaactccttcgccaccctggcagtgccggacgcctactttgacatggtgcgc
ccgggcggcctgctctacggtgactccatcccctcctacaccgaatacaaacgggtgatg
gcattcaagacccaggttgcctcggtcaaccactatgcggcgggcaacaccgtcggttat
gaccgcacctttactctcaaacgtgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgtgcgctcagcaacaaggcctatgtgctgatccagggtcagaaggtg
ccggtggtcggcaagacctccatgaacaccatcatggtggacgtgaccgatctgaaaggg
gtgaagcccggtgatgaagtggtgctgtttggccgtcagggtgaggcagaagtgaaacag
gctgatctggaggagtacaacggcgccctgttggcggacatgtacaccatctggggctac
accaaccccaagaagatcaaacgctga

DBGET integrated database retrieval system