KEGG   Aeromonas salmonicida O23A: O23A_p1452Help
Entry
O23A_p1452        CDS       T04990                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aeo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    O23A_p1452
Enzymes [BR:aeo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     O23A_p1452
Transporters [BR:aeo02000]
 Other Transporters
  Pores ion channels [TC:1]
   O23A_p1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ARW82195
UniProt: A0A1Z1NNA5
LinkDB All DBs
Position
1519878..1520513
Genome map
AA seq 211 aa AA seqDB search
MITLYGTPVSRALRISWLLEELGVAWQFQFLDFAKGENRSEWFLALNPSGKMPVLKDGDF
VLTESAAIMQYLAEVYGSDWLPARGTQASALHAQWISFITCELEQPLWTIGKHKFALPEP
QRLPAIFPTAKWEFDKAAAIAESWVPEQGYLLGEQITIADLLLAHTLMWATRFEQTIPPK
LAAYRDRLAKRPALQAVLAKTQAIADAAQAS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatacggaaccccggtcagccgggcactgcgcatatcctggttactggaa
gagttgggcgtggcgtggcaatttcagtttctcgacttcgccaagggcgagaatcgcagt
gagtggtttctggcgctgaacccgagcggcaagatgccagtgctcaaagacggggatttc
gtactgaccgaatccgccgccatcatgcagtacctggccgaagtttatggctcggattgg
ctgccagccagagggacgcaggcatccgcgttgcatgcccagtggatcagcttcattacc
tgtgagctggagcaacccttgtggaccatcggcaagcacaagtttgccctgccggaaccc
cagcgcctgccagccatcttccccaccgccaagtgggagtttgacaaggcggcggccatc
gccgagtcctgggtgcccgagcagggctacctgctgggggagcagatcaccatagcggat
ctgctgctggcccataccctgatgtgggcaacccgcttcgagcagaccattcctcccaaa
ctggccgcctatcgggatcgcctggccaaacgccctgccctgcaagccgtgctggccaaa
acccaggccatcgcagacgccgcccaggccagctga

DBGET integrated database retrieval system