KEGG   Aeromonas salmonicida O23A: O23A_p1545Help
Entry
O23A_p1545        CDS       T04990                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00473  D-Alanine metabolism
aeo00550  Peptidoglycan biosynthesis
aeo01100  Metabolic pathways
aeo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    O23A_p1545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O23A_p1545
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    O23A_p1545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
    O23A_p1545
Enzymes [BR:aeo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     O23A_p1545
Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
 Precursor biosynthesis
  Amino acid ligase
   O23A_p1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ARW82288
UniProt: A0A1Z1NNL7
LinkDB All DBs
Position
complement(1621208..1622197)
Genome map
AA seq 329 aa AA seqDB search
MKNMHVLLLCGGGGSEHEVSLRSANFLEQQLGLVSGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQNDAALTEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
QGIKDAFGYSEQVLIEKAVKPRELEVAVYQYGDELIATYPGEICVPQDKFYTYEEKYSSA
SHTATSLKAEGLTQAQEDAIHEYALKAFRQLKLTHLSRIDFFLTEDGEILLNEINTFPGM
TSISMFPKLLEHHGHRFAHYLEQILRKLA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggcggtggctcagaacacgaagtctct
ctgcgcagcgccaatttccttgagcaacaactcggtttggtgtccggtgtcgaagtgacc
cgggtcgagatgtttgccgaccgctggctctctgccgatggccgcgagtgcaagctgggg
ctggacaagctgctctcgtttgacagcgtggcccgtccggtggactacgtggtgccctgc
atccacggctacccgggtgagacgggcgatctgcaatccttcctcgagctggcgggcctg
ccttatctcggttgcgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctctgccatcggcatccccaacaccccctatctgttcctgactgaacagaac
gacgccgccctgaccgaggcaaaagccgcactggccaagtggggcaaggtgtttatcaag
gccgcttcccagggctcctccgtggggtgttattccgccagcaacgaagccgacctagtg
cagggcatcaaggatgccttcggttactccgagcaggtgttgatcgaaaaagcggtcaag
ccgcgcgagctggaagtggctgtctaccagtacggtgacgagctgattgccacttatcct
ggcgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agccacacggcgaccagcctcaaggccgaaggcctgacccaggcccaggaagatgcaatt
cacgagtatgccctcaaggcgttccgtcagctgaaactgacccatctgtcgcgcatcgac
ttcttcctgacggaagatggcgagatcttgctgaacgaaatcaataccttccccggcatg
acttccatctccatgttcccgaaactgctggagcatcacggtcaccgctttgctcactac
ctcgagcagatcctgcgcaaactcgcctga

DBGET integrated database retrieval system