KEGG   Aeromonas salmonicida O23A: O23A_p1602Help
Entry
O23A_p1602        CDS       T04990                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00564  Glycerophospholipid metabolism
aeo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    O23A_p1602
Enzymes [BR:aeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     O23A_p1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 Pyr_redox_2 DAO_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ARW82345
UniProt: A0A1Z1NNQ3
LinkDB All DBs
Position
1686646..1688340
Genome map
AA seq 564 aa AA seqDB search
MKRITTQVVIIGGGATGAGIMRDCALRGIDCILLERDDIAAGTTGRNHGLLHSGARYAVT
DPESARECIQENRILKRIASHCVEDTGGLFVTLPEDDIHFQKTFMDACALAGIDTRQLDP
ADALRLEPNVNPALIGAIQVPDGTVDPFRLAAANVLDAKEHGARIFTHSKVLGLLRNQDR
VYGVKAINTRTGEAFEVEAQEVVNAAGIWGQQICEYADLGIRMFPAKGSLLIMDYRINQM
VLNRARKPADADILVPGDTISLIGTTSSRIDYHKIDQLTVDPDEVEVLLREGIKLAPIMA
RTRLLRAYAGVRPLVAVDGDETGRNISRGIVLLDHSDRDGLQGFNTITGGKLMTYRLMAE
WATDLIAKKIGNTKPCRTAELSLPGSRDPEKVSAPGLSAPAEGSAQYRHGERVIAFFRDN
PKANALICECEMVTAGEIEYALRELDVDNLVDLRRRTRLGMGPCQGELCAYRAAGLMQEY
GKADGRQACVMLRQFLEERYKGTRPVLWGDALREAEFTYWIYEGLFGLGEWTAPHLVAEP
PFPLDPVTRTEDHSQAPLTQGVQS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataaccacacaagtcgtcatcatagggggtggcgcaaccggagccggcatc
atgcgcgattgcgcactgcgcggcatcgactgcatcctgctggagcgcgatgacatcgcc
gccggcaccacgggccgcaaccacggtttgctccactctggcgcccgctatgcggtgacg
gatccggaatccgcccgcgagtgcattcaggaaaaccgcatcctcaagcggatagccagc
cactgcgtcgaggacacgggcggtctcttcgtcaccctgccggaagatgacatccatttt
caaaaaacctttatggatgcctgcgccctggcgggtatagatacacgccagctggatccg
gccgatgcgctgcgcctcgagcccaacgtcaacccggccctgataggggctattcaagta
ccggacggcactgtggatcctttccgcctcgccgccgccaacgtactggatgccaaggaa
cacggcgcgcgcattttcacccacagcaaggtgctggggctgctgcgcaatcaggacagg
gtctatggcgtcaaggccatcaacacccgcaccggtgaagccttcgaagtggaggcccag
gaggtggtgaacgctgccgggatctggggccagcaaatttgcgaatacgccgatctcggc
atccgcatgttcccggccaagggctccctgctcatcatggattaccgcatcaaccagatg
gtgctcaaccgcgctcgcaaacctgcggatgcggacatactggtgcctggcgataccatc
tccctcatcggcaccacctcaagccgcatcgactatcacaagattgatcagctcaccgtg
gatccggacgaggtggaggtgctgctgcgtgaggggatcaagctcgcccccatcatggcg
cgcacccgtctgctgcgcgcttacgccggggttcgccccctggtggcggtggatggcgac
gagaccggccgcaacatcagccgcggcatagtgcttctcgatcacagcgatcgtgacggc
ctgcagggcttcaacaccatcaccggcggcaagctgatgacctatcggctgatggccgag
tgggccaccgacctcatcgccaagaagataggcaacaccaagccatgccgcaccgccgaa
ctgagcctgccaggctcgcgggatccggagaaagtgtccgcccccggtctgtcggcaccg
gcagaaggctcggcccagtatcgccacggcgagcgggtcatcgccttctttcgagacaat
cccaaggccaacgccctcatctgcgaatgcgagatggtgacggccggcgaaatcgagtac
gccctgcgcgagctggacgtggacaacctggtggatctgcgccgtcgcacgcgtttggga
atgggcccctgtcagggtgagctctgtgcctaccgggccgccggtctgatgcaggagtat
ggcaaggccgatggccgccaggcctgcgtcatgttgcgccagttcctggaagagcgttac
aagggcacccgccccgtgctgtggggcgatgccctgcgcgaagcggagtttacctactgg
atctacgaagggctgtttggtctgggagagtggacggcgccccatctggtggccgagccc
ccctttcctctcgaccccgtgaccaggacagaagaccacagccaggccccattgactcaa
ggagtgcagtcatga

DBGET integrated database retrieval system