KEGG   Aeromonas salmonicida O23A: O23A_p1643Help
Entry
O23A_p1643        CDS       T04990                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00020  Citrate cycle (TCA cycle)
aeo00190  Oxidative phosphorylation
aeo00650  Butanoate metabolism
aeo01100  Metabolic pathways
aeo01110  Biosynthesis of secondary metabolites
aeo01120  Microbial metabolism in diverse environments
aeo01130  Biosynthesis of antibiotics
aeo01200  Carbon metabolism
Module
aeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aeo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O23A_p1643
   00650 Butanoate metabolism
    O23A_p1643
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O23A_p1643
Enzymes [BR:aeo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O23A_p1643
    1.3.5.4  fumarate reductase (quinol)
     O23A_p1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ARW82386
UniProt: A0A0W0ASJ7
LinkDB All DBs
Position
complement(1743846..1744562)
Genome map
AA seq 238 aa AA seqDB search
MNVTFSVYRYNPDVDNVPYMKEYRLDIPEGSDMMVLDALIQLKELDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPLSDLLKKGNNVVIRPLPGLPVIRDLVIDMTQFYTQWEKVKPF
LINDEKLPPVREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
WLADSRDTAATERLGNLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGQIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacattctctgtctacagatacaatccggatgttgataacgtcccctatatg
aaggaatatcgtcttgatattcctgaaggttccgacatgatggtgctcgatgcactgatc
cagttgaaagagctggaccccacactcgcctttcgccgctcttgccgcgaaggagtctgt
ggatcagacggtctcaacatgaatggcaagaatggtcttgcctgcatcaccccgctctcc
gatctgctgaagaagggcaataacgtcgttatccgccccttgcctggcctgccggtgata
cgcgatctggtgatcgacatgacccagttctacacccagtgggagaaggtcaaacctttc
ctcatcaacgatgaaaaattgccgcccgtgcgtgagcacctgcaatcccccgaagagcgc
gccaagctggatggcctgtacgagtgtattctctgtgcttgctgctccacctcttgcccc
tccttctggtggaacccggacaagttcatcggcccggccggtctgctcgcagcctaccgc
tggttggctgacagccgcgacaccgccgccaccgaacgactgggtaacctggatgacgcc
ttcagcgtgttccgttgccacggcatcatgaactgcgtgaacgtctgtcccaagggcttg
aacccgaccaaagccatcggtcagatcaagtcgatgctgctcaatcgggctgtttag

DBGET integrated database retrieval system