KEGG   Aeromonas salmonicida O23A: O23A_p1644Help
Entry
O23A_p1644        CDS       T04990                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00020  Citrate cycle (TCA cycle)
aeo00190  Oxidative phosphorylation
aeo00650  Butanoate metabolism
aeo01100  Metabolic pathways
aeo01110  Biosynthesis of secondary metabolites
aeo01120  Microbial metabolism in diverse environments
aeo01130  Biosynthesis of antibiotics
aeo01200  Carbon metabolism
Module
aeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aeo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O23A_p1644
   00650 Butanoate metabolism
    O23A_p1644
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O23A_p1644
Enzymes [BR:aeo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O23A_p1644
    1.3.5.4  fumarate reductase (quinol)
     O23A_p1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARW82387
UniProt: A0A0W0BH92
LinkDB All DBs
Position
complement(1744697..1746463)
Genome map
AA seq 588 aa AA seqDB search
MTIPTREFDAVVIGAGGAGMRAALQIAQSGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HDDNWQWHMYDTVKGSDYIGDQEAIEYMCKTGPEAIYELENMGLPFSRFDNGSVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNVKSKTTVFSEWYALDLVKNQDGHIVGC
TAIDMESGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVGVQDMEFWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPIIPTCHYMMGGV
PTNVNGQCLAQDKDGNDVPVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLV
NTLGEMDHGRDASESDIDAAMARFNRWENTRDGEDPVQIRKDLQTCMQNNFSVFREGDAM
AEGLAELKLIRERLKNARLDDTSKEFNTQRIECLELDNLMETAFATAVAANFRTESRGAH
SRFDFPDRDDEGWLCHSLYHPDTESMTRRAVNMSPKTREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccaactcgtgaatttgatgcggtcgtgattggtgccggtggtgctggtatg
cgcgccgcgctgcagattgcccaatccggcaagagctgcgctctgttgtccaaggtcttc
ccgacccgttctcatactgtttccgcccagggcgggatcacggttgcgctgggcaatgcc
cacgatgacaactggcaatggcacatgtatgacaccgtcaaaggctccgattacatcgga
gaccaggaagcgatcgaatacatgtgcaagacaggtcccgaggccatctatgagctggag
aacatgggcttgcccttctcccgcttcgacaacggctccgtttaccagcgtccgtttggc
ggccagtccaagaattttggtggcgagcaggcggcccgcactgcggctgctgctgaccgt
accggtcacgccctgctgcacaccctctatcaacagaacgtcaagagcaagaccaccgtt
ttctccgagtggtatgcgctggatctggtgaaaaaccaagatggtcacatcgttggctgt
accgccatcgacatggagagcggcgaagtcgtctacttcaaggccaaggccacagtgctt
gccaccggcggcgccggtcgaatctaccagtccaccaccaatgcccacatcaacaccggt
gacggtgtcggcatggcgctgcgcgctggcgtcggcgtacaggacatggagttctggcag
ttccacccgaccggcattgccggggcaggggtactggtgaccgaagggtgtcgcggtgaa
ggcggctatcttttgaacaaggatggcgagcgcttcatggagcgttacgcgccgaacgcc
aaggacctggccggtcgcgacgtggtggctcgttccatcatgatcgaaatccgcgaaggc
cgtggttgcgatggtccctggggcccgcacatcaagctcaagctggatcacctcggcaaa
gaggtgctggaatcccgtctgccagggatctgcgagctctctcgcaccttcgcccacgtg
gatccggtcaaagagcccatcccgattatcccgacttgccactacatgatgggcggcgtg
ccgaccaacgtgaacggtcagtgtctggcccaggataaagacggcaatgacgttcctgtg
gtcggtttgtttgcggtaggggagatagcctgcgtctccgtgcacggtgccaaccgcctc
ggcggcaactcgctgctggatctggtggtgtttggccgcgcggccggcatgcacctagtc
aatactctgggcgagatggaccacggtcgcgatgccagcgaatctgacatcgacgctgcc
atggcccgcttcaatcgctgggaaaacacccgcgatggggaagacccggtccagatccgc
aaggacctgcagacctgcatgcagaacaacttctccgtgttccgtgaaggtgacgccatg
gccgaagggctggccgagctcaagcttatccgcgagcgtttgaagaatgcccgtctggat
gacacctccaaggagttcaatacccagcgcatcgagtgcctggagctggacaacttgatg
gagacggcgttcgccaccgcggtggcggccaacttccgtaccgagagtcgtggtgctcac
agccgcttcgatttcccggatcgcgacgatgagggttggctgtgccacagcctctatcat
ccggacaccgagtccatgacccgtcgcgctgtcaacatgtctccgaaaacacgcgaggca
ttcccacccaaggtgcggacttactga

DBGET integrated database retrieval system