KEGG   Aeromonas salmonicida O23A: O23A_p1826Help
Entry
O23A_p1826        CDS       T04990                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aeo  Aeromonas salmonicida O23A
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O23A_p1826
Enzymes [BR:aeo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     O23A_p1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ARW82569
UniProt: A0A1Z1NPL0
LinkDB All DBs
Position
1944039..1945631
Genome map
AA seq 530 aa AA seqDB search
MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAREISEMSPKIAMTDGSNARK
PSMSVAPQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKTDPAVLEQIKQLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYMNGQPFS
QGRISLEEIIAKLDTGAADRKAAELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVE
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMNARTTEVIGDGSKVVG
MDYEDRTTGEIKHLGVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNAAPEAAETSAKADAVTA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacagctgaacacctatctgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaacgacagtgacaaatccgcagaactgctggcattggcc
cgcgagatcagcgagatgtccccaaaaattgccatgactgatggcagtaatgcccgcaag
ccttccatgagcgttgcaccacagggccaagccccgcgcgttcattttgccggcatcccc
atgggtcatgaatttacctctctggtgctcgccttgctgcaaagcggcggccacccttcc
aagacagatccggccgtactggagcagatcaagcagctgaagggcgagtttcacttcgag
acctatatctccctctcctgccacaactgcccggacgtggtacaggcgctgaacctgatg
gcgaccctgaatcccggtatcacccacaccatgatcgacggagccctgttccaggacgaa
gtgaacgagcgccagatcatggcggtgccgaacgtctacatgaacggtcagccgttcagc
cagggccgtatctcgctggaagagatcattgccaagctcgataccggtgcggccgatcgc
aaggccgccgaactgagcgaaaaagccccctatgacgtgctggtagtgggtggtggcccg
gctggtgccgcagcagccatctatgccgcccgtaaaggcattcgtaccgccatcgtcgca
gagcgttttggtggtcaggtgatggacacggtcgggatcgagaacttcatctccgtgccc
tacaccgaaggtcccaagctggccgccagcctggagcagcacgtcaagcagtacggtgtg
gaagtgatcaccgagcagcgtgccgccgccatcagcaaggacggctatgtgaatgtggag
cttgcctctggcgctactctgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgtgacctgaatgtgccgggcgagctcgagtaccgtaccaagggcgtggcctactgcccc
cactgcgacggtcccttcttcaagggcaagcgcgtggcagtaataggtggtggtaactcc
ggtatcgaagcagccatcgatctcgccggcattgtcgagcacgtcacagtggtggaattt
gccgataccctgcgcgccgacgaagtgctgcagaaaaaagcccgctccatgggcaacatc
gacatcatcatgaacgcccgcaccaccgaagtgatcggtgatggcagcaaggtggtgggg
atggattatgaagatcgcaccacgggtgaaatcaagcacttaggcgtggctggcatcttc
gtccagatcggactggtgccgaacaccgagttcctcaaggggagcgaggtggcactgacc
cgcttcggcgagatcgagatcgacaccaagggcgccacttccctgcctggtgtctatgct
gccggtgacgccactacagtgccgttcaagcagatcatcatctccatgggagccggtgca
accgcagcgctgggtgcatttgattacctcatccgcaatgcggcgccggaagcggcagaa
acatccgccaaggctgatgccgtaaccgcctga

DBGET integrated database retrieval system