KEGG   Aeromonas salmonicida O23A: O23A_p2287Help
Entry
O23A_p2287        CDS       T04990                                 

Definition
(GenBank) Gamma-aminobutyrate/alpha-ketoglutarate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00250  Alanine, aspartate and glutamate metabolism
aeo00280  Valine, leucine and isoleucine degradation
aeo00410  beta-Alanine metabolism
aeo00640  Propanoate metabolism
aeo00650  Butanoate metabolism
aeo01100  Metabolic pathways
aeo01120  Microbial metabolism in diverse environments
Module
aeo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O23A_p2287
   00650 Butanoate metabolism
    O23A_p2287
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O23A_p2287
   00280 Valine, leucine and isoleucine degradation
    O23A_p2287
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O23A_p2287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aeo01007]
    O23A_p2287
Enzymes [BR:aeo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O23A_p2287
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     O23A_p2287
Amino acid related enzymes [BR:aeo01007]
 Aminotransferase (transaminase)
  Class III
   O23A_p2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARW83030
UniProt: A0A1Z1NQT6
LinkDB All DBs
Position
2444188..2445492
Genome map
AA seq 434 aa AA seqDB search
MSHSDSHADNNQAWQARREAAVVNGVGTLLPVFIKRAKNAELWDVEGNRYIDFASGIAVL
NTGHNHPKVVAAVREQLEKFSHTCFQVTPYPGYIELAEKLNALVPGSTPKRTLFLSTGAE
AVENAIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPS
DYLGVSEADALAALDLCFSSDIEPARVAAIILEPVQGEGGFYSASPSFMQSLRKLCDQHG
IVLICDEIQSGFCRTGKTFATEYSGIEPDIMTLAKSLAGGFPLSAVVGKAAIMNAAKPGG
LGGTYAGSPIACAAALAVLEVIEEEQLNQKALAQGEQIKARLHQLAEGFDCIGDIRGPGA
MVAMELVKGRDASQPDPDLTKRLVAEAGKRGLVLLSCGVRANVIRFLAPLTATSALIEEG
LALLEQALTAASQG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattcagatagccatgcagacaacaaccaggcctggcaggcccgccgtgaagcg
gccgtggtcaacggcgtcggcaccctgctgccggtgtttattaagcgggcgaagaacgcc
gagctgtgggatgtggagggcaaccgctacatcgactttgcctccggcatcgccgtgctc
aacacgggccacaaccaccccaaagtggtggcggcagtgcgtgaacagctcgaaaaattc
agccacacctgctttcaggtgaccccctaccccggctatatcgagcttgccgagaagctc
aacgccctggtgcccggctctacgccaaaacgcaccctgtttctctccaccggcgccgag
gcggtggagaacgccatcaagatagcccgcgcccacacgggccgcagtggcaccatcgcc
ttcaaggggggcttccacggtcgcaccatgatgggaatggcgctcaccggcaaggtagtg
ccctacaaaacgggtttcggccccttcccgggagaggtctatcacctgcccttcccgagc
gattacctgggggtgagcgaggccgatgcccttgccgcgctggatctctgcttcagctcg
gatatagaaccggcccgggtggcagccatcattcttgaacccgtgcagggtgaagggggt
ttctactccgcttctcccagctttatgcagagcctgcgcaagctgtgcgatcagcacggc
atagtgctcatctgtgacgagatccagagcggtttctgtcgcaccggcaaaacctttgcc
actgaatacagcggcatagaaccagacatcatgaccctagccaagagtctagccggtggc
ttccctctctcggccgtggtgggcaaggcggccatcatgaacgctgccaagccgggcggt
ctggggggcacttatgcgggttcccccatcgcctgcgccgccgccctggcggtgctggag
gtgatcgaagaggagcaactcaaccagaaagccctggctcaaggggagcagatcaaggct
cgcctgcatcagttggccgagggttttgactgcatcggcgacattcgcggccccggcgcc
atggtggccatggagctggtcaagggccgggatgccagccagcctgacccggatctcacc
aaacggctggtggccgaggccggcaaacgcgggcttgtgctgctctcctgcggcgtgcgg
gccaacgtcatccgcttcctggcgccccttaccgccacttcggccttgatcgaggaaggg
ctggctctgctggaacaggcgctcaccgccgccagtcagggctag

DBGET integrated database retrieval system