KEGG   Aeromonas salmonicida O23A: O23A_p2813Help
Entry
O23A_p2813        CDS       T04990                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
aeo  Aeromonas salmonicida O23A
Pathway
aeo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aeo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O23A_p2813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aeo01003]
    O23A_p2813
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
    O23A_p2813
Enzymes [BR:aeo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     O23A_p2813
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     O23A_p2813
Glycosyltransferases [BR:aeo01003]
 Polysaccharide
  Bacterial polysaccharide
   O23A_p2813
Peptidoglycan biosynthesis and degradation proteins [BR:aeo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   O23A_p2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ARW83552
UniProt: A0A1Z1NS23
LinkDB All DBs
Position
complement(3000145..3002460)
Genome map
AA seq 771 aa AA seqDB search
MATQRRKRTPKKVAPKRTIWRKLFWLGFKLSLVVAAFMVVFGIYLDTKVRERFDGEKWQL
PVMVYSRPLELYPSQRLSQAQMLRELNMLSYKQVRQPHTPGEYAVSGNRIELIRRPFAFH
DGADGARGLRLTFSGARLEGIQSLENQRQLGYAQMDPVLLDRLNTEDREDRLLVRIAEVP
DSLLITLLTTEDRDFYQHGGVSPVAIMRAMVANVLAGRTVQGGSTLTQQLAKNFFLTRER
SLWRKLQEAYMAVLIDYRYSKDEILEAYLNEVYLGQNFSQGVYGFGLASYFYFGIPVNEL
DIDQVALLVGLVKGPSYYDPWRFPERAKARRDLVLKLLMDHGSLQAAEYELASKQPLGII
TRGQMSYGRTPAFMGLLKREIQSRFGPDLLKQSGLKIFTSLDPIAQHAAEQAVASGLALI
EKQRGKKKLEAAMVVSDWHKGEVVALVGGRDPRYAGFNRALDARRQIGSLVKPAVYLTGL
SNGLTLASPLKDQPIRIRGKDGQIWTPQNYDRKFRQSVPLMDALASSLNVPTVNLGLQVG
LEKVVDTLHKLGVEQEIQPYPSLVLGAVALSPMEVNQMYLPIANQGMTQPLSAIRAVVNS
DGSTLYQHDQTAKRVTDEQASWLTLFAMTKTVSQGTARSLNAKFPGATMAGKTGTTNELR
DSWFAGLDNNELVSVWVGRDDNTPAGLTGSNGALQLFSGYMGQRGVNSLAIKMPQGVSWA
NFSRASGARVASDCPGSLQVPAKLAGLAESMSCSSPSPRSALDDWFGGFFN
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcaacgacgcaagcgcacccccaagaaggtggcgcccaaacgcaccatctgg
cgcaagctgttctggcttggcttcaagctctcactggtggtggcggccttcatggtggta
tttggcatctatctcgataccaaggtgcgcgagcgctttgacggggagaagtggcaactg
ccggtgatggtttacagtcgtccgctggagctctatcccagccagcgcctctcccaggcc
cagatgctgcgcgagctcaacatgctgagctacaagcaggtgcgtcagccccatactccg
ggcgagtacgcagtgagtggcaatcgtatcgagctcatccgccgtccattcgccttccat
gacggcgccgacggtgcccgtggcctgcgccttaccttcagcggcgctcgcctggaaggg
atccagtctctggagaaccagcgtcaactcggttatgcccagatggacccggtactgctc
gaccgcctcaataccgaggatcgggaagatcgtctgctggtgcgcatcgccgaggtgccg
gacagcctgctcatcacgctgctgaccacagaggatcgcgacttttaccagcatggcggc
gtctcgccggttgccatcatgcgtgccatggtggccaacgtgctggccggtcgtaccgtg
caagggggcagtaccctgactcagcagctggccaagaacttcttcctgacccgcgaacgc
agcctgtggcgcaaactgcaggaagcctacatggcggtgctgatcgactaccgctatagc
aaggacgagatcctggaggcctatctcaacgaggtctatctggggcagaacttctcccag
ggggtatatggcttcgggctcgcctcctacttctacttcggcattccggtcaacgagctg
gacatagatcaggtcgccctgctggtggggctggtgaagggaccttcctattacgatccc
tggcgcttcccggagcgggccaaggcccgtcgtgatctggtgctcaagctgctgatggat
cacggcagcctgcaagcggccgagtacgaactggccagcaagcagccgcttggcatcatt
acccgtggccagatgagctatggccgcaccccggcctttatgggcctgctcaagcgcgag
atccagagccgtttcgggcctgatctgctcaagcagtccggcctcaagatcttcaccagc
ctggatcccatcgcccagcatgccgccgagcaggcggtcgcatcgggactggcactcatc
gagaagcagcgtggcaagaagaagctggaggcggccatggtggtctccgactggcacaag
ggtgaagtggttgcactggtgggtggccgggatccgcgctacgccggtttcaaccgggcg
ctggatgcccgccggcagattggctctctggtcaagcctgccgtctatctgaccggcctc
tccaacggactgacgttggcgagcccgctcaaggaccaaccgatccgcatccgtggcaag
gatggccagatctggacaccgcagaactatgatcgcaagttccgccagagcgtgcctttg
atggatgcgctggccagctccctcaacgtgccaactgtcaacctgggtctgcaagtgggg
ctggagaaggtggtggatacattgcacaagctgggggtagagcaggagatccagccctac
ccgtcgctggtgttgggggctgttgccctctcccccatggaggtgaaccagatgtatctg
cccatcgccaaccaggggatgacccagcccttgtcggccatccgcgccgtagtcaacagc
gatggcagtactctctatcagcatgatcagactgccaagcgggtcacggacgagcaggcc
agctggctcaccctgtttgccatgaccaagacggtgagccaaggcacggcccgctcactc
aacgccaagttccccggtgccaccatggcgggcaagacaggcaccaccaacgagctgcgc
gactcctggtttgccgggctggacaacaacgagctggtcagtgtctgggtggggcgtgac
gacaacacaccggcggggctgacaggctccaatggcgccctgcaactgtttagcggttac
atgggccagcgtggcgtcaacagccttgccatcaagatgccgcaaggggtgagctgggcc
aacttctcccgcgccagcggggccagagtggccagcgattgcccgggcagcctgcaggtg
cctgccaagctggccgggctggccgagtccatgagctgcagcagcccgtcgccccgcagt
gcactggatgactggttcggtggtttcttcaactga

DBGET integrated database retrieval system