KEGG   Altererythrobacter epoxidivorans: AMC99_00261Help
Entry
AMC99_00261       CDS       T04070                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aep  Altererythrobacter epoxidivorans
Brite
KEGG Orthology (KO) [BR:aep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMC99_00261
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMC99_00261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO K_oxygenase NAD_binding_8 AlaDh_PNT_C Thi4 FAD_binding_3 Spermine_synth FMO-like Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ALE15577
UniProt: A0A0M4M5T5
LinkDB All DBs
Position
complement(252874..254463)
Genome map
AA seq 529 aa AA seqDB search
MLDDTMKQQLKTYLANLREPVELVASLGEGEKSDQTRQLLEEIAALHDDVSASFDGTDAR
KPSFIIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKFDADLLEQVRGLEGDFE
FEMYFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFKDEVDAREVMAVPATFLNGEP
FYNGKMELAEILARLDTNADARAAEKLADKPPFEVLVIGGGPAGAAAAIYTARKGFSTGI
AAERFGGQLNDTLGIENLPGTPYTEGPKLAADLQRHVGEYEIDTINLARAVELVPATKEG
GLHQVRLANGATLKARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAKIVGHVTLVEFDEKLRADEVLQAKLRSMPNVEIVTSGQTTEITGN
NGKVDGMIVKNRKSGEERRIELEGVFVQIGLVPNTEWLAESGLELSKHGEIVTDEEGRTN
LPGIFGAGDVTTVPYKQIVVAMGEGSKAGLSAFDYLIRTEPVEEIAAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgatacgatgaagcaacagctcaagacctatcttgccaacctgcgcgagccg
gtcgaactggtcgcatcgctcggcgaaggcgagaagtcggaccagacgcgccagctgctc
gaggaaattgccgcgctccacgacgatgtgagcgccagcttcgacggcaccgatgcgcgc
aagccgagcttcatcatccgccgcgcaagcgatgcggaaaagtgggttcgcttcgccggc
ctgccgatggggcacgagttcacctcgctggtgctcgcgctgctttgggccggtggtcac
ccgccgaaattcgacgccgacctcttggaacaggtgcgcggcctcgaaggcgatttcgaa
ttcgagatgtatttctcgctttcctgccacaactgccccgacgtggtgcaggcgctgacg
ctgatggcgctggaaaacccgcgcatcactgcgaccctgatcgagggcggcacgttcaag
gacgaggtcgatgcgcgcgaggtcatggccgtgcccgcgaccttcctcaacggcgagccc
ttctacaacggcaagatggagctggccgaaatcctcgccaggctcgacaccaatgccgat
gccagggctgcggaaaagctggctgacaagccgcctttcgaagtgctcgtcatcggcggc
ggtccggccggtgcggctgcggcgatctataccgcgcgcaagggcttcagcaccggcatc
gcggccgaacgcttcggcgggcagctcaacgatacgctcggtatcgagaaccttcccggc
acgccctacaccgaagggcccaagctcgctgccgacctgcaacgccacgtcggcgaatat
gagatcgatacgatcaacctcgcccgcgcggtcgaactggtccctgccacgaaggaaggc
ggcctccaccaggtcaggctcgccaatggagcgacgctgaaggcacgctcgctcatcctg
tcgaccggtgcgcgctggcgcaacctcggcgtcccgggtgaagcggaatatcgcaacaag
ggcgtggcctattgcccgcactgcgacggtccgctgttcaagggcaagcgcattgcggtg
atcggcggaggcaattcaggcgtggaagcggcgatcgaccttgccaagatcgtgggccac
gtcaccctggtcgaattcgacgagaagctgcgcgcggacgaggtcctgcaggccaagctg
cgcagcatgcccaatgtcgaaatcgtcaccagcggccagacgaccgagatcaccggcaac
aatggcaaggtcgacggcatgatcgtcaagaaccgcaagtcgggtgaagagcggcggatc
gagctcgaaggcgtgttcgtccagatcggtcttgtccccaacaccgaatggctggccgaa
agcggtctggaactgtcgaagcacggcgagatcgtgaccgatgaggaaggccgcaccaac
ttgcccggcatcttcggcgcaggcgacgtgaccaccgtcccctacaagcagatcgttgtc
gcaatgggcgaaggttcgaaggccggcctgtctgccttcgactatctgatccgtaccgaa
ccggtggaagagatcgcagccgccgcctga

DBGET integrated database retrieval system