KEGG   Altererythrobacter epoxidivorans: AMC99_00392Help
Entry
AMC99_00392       CDS       T04070                                 

Definition
(GenBank) Cyclohexanone monooxygenase
Organism
aep  Altererythrobacter epoxidivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_8 Pyr_redox_2 Pyr_redox_3 FMO-like K_oxygenase FAD_binding_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ALE15704
UniProt: A0A0M4LSV7
LinkDB All DBs
Position
373696..375495
Genome map
AA seq 599 aa AA seqDB search
MGEHAAQVVDKQALRAKYAEERDKRLRADGSAQYRRLETEFSDLATDPYTPRVEREPVTD
HVTFAFIGGGFAGLVVGARLKDAGIDDVRILEKGGDFGGTWYWNRYPGAQCDTASMIYMP
LLEETGHMPTEKYAHAPEIREHCSRIGKQYGLYDNALFHTQVSDLEWDDARKVWIVRTDR
GDEFTAKYVGMGTGPLHVAKLPGLPGIENFKGKAFHTSRWDYAYTGGNPEGAPLSKLADK
RVAIIGTGATAVQCVPHLARDAKELLVFQRTPSSVDVRNNKPLEREWFDGVAEPGWQKKW
QENFVGNLAGGFAAEDLVQDGWTDLGHRIRKEIMNLPPEERTPANVMAAYEDADNQKMSE
IRARAEAIVGGEAGKKLQAWYRQLCKRPCFHDEYLQAYNEPGCRLVDTDGKGVERITEKG
VVANGVEYEVDCIIYASGFEVGTEYASRAGFQVTGRDGETLSQHWDGGMKTLHGLHMHGF
PNAFMVQPTQAANMIANVPHNIVDHADTIAAVVSEAERRGAQTVEASAEAEKAWVDLLLT
GLGARLGDTGCTPGYYNNEGEGFGEAAKYSVGHPAGAMGYFNHIDAWRKSGEYKGLEFA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcatgccgctcaggttgtcgacaaacaggcgctccgcgcgaaatatgcggaa
gagcgtgacaagaggctgcgtgccgacgggtcggcgcaatatcgccggctggaaacggag
ttttccgatctcgctaccgatccctataccccacgggtcgaacgcgagccggtcaccgat
cacgtaaccttcgccttcatcggcggcggatttgcagggctggtcgtgggcgcgcggctg
aaggacgcaggcatcgacgatgtccgcatcctcgaaaaaggcggcgacttcggcggcacc
tggtactggaaccgctaccccggcgcgcagtgcgacaccgccagcatgatctacatgccg
ctgctcgaggaaaccgggcacatgccgaccgaaaagtacgcccatgcgccggaaatccgc
gagcattgttcgcgcatcggcaagcagtacggcctttacgacaacgcgctgttccacacg
caggtgagcgaccttgaatgggacgacgcgcgcaaggtctggatcgtgcggaccgaccgc
ggcgacgaattcaccgccaaatatgtcggcatgggcacagggccgctgcatgtcgcgaag
ctgcccgggctgccgggtatcgagaatttcaagggcaaggcgtttcacaccagccgctgg
gattatgcctataccggcggcaatcccgaaggcgcgcctttaagcaagctggcggacaag
cgggtcgcaatcatcggtaccggcgcgacggccgttcagtgcgtcccgcatctggcccgc
gatgcaaaggaattgctggtgttccagcgcaccccgtcatcggtcgatgtgcgcaataac
aagccgctcgaacgcgaatggtttgatggcgtggccgaaccgggctggcagaagaaatgg
caggaaaacttcgtcggcaatcttgcaggcggatttgccgcagaggacctggtccaggac
ggctggaccgaccttggccaccgtatccgcaaggaaatcatgaacctgccgcccgaagaa
cggactccggccaatgtcatggcagcttacgaggatgccgataaccagaagatgtcggaa
atccgcgcgcgcgctgaggccatcgtcggcggcgaagcgggcaagaaactgcaggcatgg
tatcgccagctgtgcaagcgcccgtgcttccacgacgaatacctgcaggcgtacaacgag
cccggctgccgcctggtcgataccgacggcaagggcgtggagcggatcaccgaaaaaggc
gtggtcgccaacggcgtcgaatacgaggtcgactgcatcatctacgcctcgggcttcgaa
gtggggacagaatatgcctcgcgcgcgggtttccaggtcaccggacgggacggagaaacc
ctgtcccagcactgggacggcgggatgaagacgctgcacgggttgcacatgcacggcttc
cccaacgccttcatggtccagccgacacaggcggcgaacatgattgccaacgtaccgcac
aatatcgtcgatcatgccgatacgatcgcggcggtcgtttccgaggctgagcgccgcggc
gcacagacggtggaagcgagcgcagaggcggagaaggcgtgggtggacctgctgctgacc
ggccttggcgcccgactgggcgataccgggtgcacgcccggatattacaacaacgagggc
gaaggcttcggcgaggctgcgaaatactcggtcggccatccggcaggcgcaatgggttac
ttcaaccacatcgacgcatggcgaaaatcgggcgagtataaggggctcgagttcgcctag

DBGET integrated database retrieval system