KEGG   Altererythrobacter epoxidivorans: AMC99_00886
Entry
AMC99_00886       CDS       T04070                                 

Definition
(GenBank) Thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMC99_00886
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     AMC99_00886
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO NAD_binding_7 FAD_binding_2 K_oxygenase FAD_oxidored Shikimate_DH FAD_binding_3
Other DBs
NCBI-ProteinID: ALE16189
UniProt: A0A0M4M704
LinkDB
Position
836710..837696
AA seq 328 aa
MATHRTKMLIIGSGPAGYSAAIYGARAMLEPIVVQGLQPGGQLTITTDVENYPGFADVIQ
GPWLMEQMQKQAEHVGTRMMWDTIVSVDLDSGPPYRAVGDSGDEYIGDTLVICTGAQAKW
LGVPGEQELGGKGVSACATCDGFFYRGKKVAVIGGGNTAVEEALYLTNHSDDVTLIHRRD
ELRAEKILQDRLFKSDKISTLWNKTVDRFEAAENGTLAHIVLKDTETGEESTLEVDGAFV
AIGHAPSTELFKGKLPLDDSGYLLTEPGSPKTEKPGVFAAGDVTDHTYRQAVTAAGMGCM
AALDAERFLSGLEIDLDGHAHAATEAAE
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcgacccatcgcaccaagatgctcattatcggctcaggcccggctggctattccgcc
gcgatttatggcgcgcgcgcaatgctcgaaccgatcgtcgtgcagggtttgcagcccggt
ggacagctgacgatcaccaccgatgtagagaactatcccggctttgccgatgtcatccag
ggcccctggctgatggagcaaatgcagaagcaggccgagcatgtgggcacgcgcatgatg
tgggacacgatcgtctcggtcgatctcgacagcgggccaccctatcgcgcggtgggtgac
agcggtgacgaatacatcggcgatacgctggttatctgcaccggcgcccaagcgaaatgg
ctgggcgtgccaggggaacaggagcttggcggcaagggcgtttctgcctgtgcgacctgc
gacgggtttttctatcgcggcaagaaggttgccgtgatcggcggcggcaacactgctgtt
gaagaagcgctgtacctgaccaatcactcggatgacgtgaccctgatccatcgccgcgac
gaattgcgcgcggagaagatcctgcaggatcgcctgttcaagtcggacaagatatcgacg
ctatggaacaagacggtcgaccgtttcgaagcggccgaaaacggcacgcttgcgcatatc
gtgctgaaagatacggagaccggtgaggaatcgaccctggaagtcgacggtgcatttgtc
gccatcggccacgctccgtcgaccgaactgttcaagggcaagctcccgctcgacgatagc
ggctatctcctgaccgagccaggcagtccgaagacagaaaagccgggcgttttcgcagcc
ggcgacgtgaccgatcacacctatcgccaggcggtgaccgcagcaggcatgggttgcatg
gccgcgctcgatgcagagcgctttctttcgggcctcgagatcgacctcgacggccatgcg
cacgccgcaaccgaggctgccgaatag

DBGET integrated database retrieval system