KEGG   Altererythrobacter epoxidivorans: AMC99_00916
Entry
AMC99_00916       CDS       T04070                                 

Definition
(GenBank) Glutathione reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00480  Glutathione metabolism
aep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMC99_00916
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     AMC99_00916
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA K_oxygenase 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ALE16219
UniProt: A0A0M5KYC7
LinkDB
Position
864223..865632
AA seq 469 aa
MAVGILDTNRHIARLTGDPHMAEYDFDLFTIGAGSGGVRASRVAAAHGARVAIAEEYRVG
GTCVIRGCVPKKMLVYGAHFAEDLEDCEQFGWKIEGKKFDWKVLRDNVLADVDRLEGAYT
DTLENHDVTIFHERAEITGDHEVTLAGGRKITAERILIATGARPRMPECQGAEHAISSNE
AFHLDELPKKVIIAGGGYIANEFAGIFNEFGSDVHIVNRGDTLLRSYDEAVRDRLLQIST
MKGIKFRFNTTFEYIKPCEEGGYFVKLSDSDEEKADLVMFAVGRVPNTEGLGLDKVGVEL
GENGEIKVDRFSKTSVDYIYAVGDVTDRVQLTPVAIREGQAFADSVFGGGDPYAVDHSCI
PSAVFSHPPIAAVGMTEGEAKNKLGSVKVYLSDFRPMKNVLAGRSERSLMKMICDGENGK
IVGIHMIAPEAPEMMQAAAIAVKAGLTKADFDATTAIHPTMAEELVLMR
NT seq 1410 nt   +upstreamnt  +downstreamnt
ttggcggttggcattctcgataccaaccgccatatcgcccgcctgacaggagatccgcac
atggccgaatacgactttgacctcttcaccatcggtgccggttccggcggcgttcgtgcc
agccgtgtggcggcggctcatggggcgagggtggccattgcggaagaataccgtgtgggc
gggacttgcgtcattcgcggctgcgtgccgaagaagatgctcgtctacggtgcgcatttc
gcagaagacctggaggattgcgaacagttcggctggaagatcgaaggcaagaagttcgac
tggaaagtcctgcgcgacaatgtcctggccgatgtcgaccggctggaaggcgcctatacc
gatacgctggaaaaccacgacgtcacgattttccacgagcgtgcggaaatcaccggcgac
cacgaggttacgttagcgggcggtcgcaagatcaccgcagaacggatcctgatcgcgacc
ggggcgcggccgcgcatgcccgaatgccagggcgctgagcacgccatcagttcgaacgag
gcgttccacctcgacgaattgccgaagaaagtcattatcgccggcggtggttacatcgcg
aacgagtttgccgggattttcaacgagttcggtagcgatgttcatatcgtcaatcgcggc
gataccctgctgcgcagctatgacgaggcagtacgtgaccgcctgttgcagatctcgacg
atgaaggggatcaagttccgcttcaacaccacgttcgaatatatcaagccgtgcgaggaa
ggcggctatttcgtgaagctttccgattccgatgaggaaaaggccgacctcgtcatgttc
gccgttggccgcgtgccgaacacagaaggtctcggcctcgacaaggtcggggtcgaactg
ggcgagaatggcgagatcaaggtcgaccggttcagcaagaccagtgtcgactatatctat
gccgtcggcgacgtgaccgatcgtgtgcaactgacgccggttgccattcgcgagggccag
gcctttgctgacagcgtctttggtggcggtgatccctatgctgtcgatcacagttgcatt
cccagcgcggtcttcagccaccccccgattgccgcggtcggcatgaccgagggcgaggct
aagaacaagctgggcagcgtgaaggtctatctgtcggacttccgcccgatgaagaacgtc
cttgccggccgcagcgagcgcagcctcatgaagatgatctgcgacggcgaaaacggcaag
attgtgggcatccacatgatcgcgcccgaagcgccggaaatgatgcaggctgcggctatc
gcggtgaaagccgggctgaccaaggcggatttcgacgcgacgacagcgatccacccgaca
atggccgaagaactcgtcctgatgcgctga

DBGET integrated database retrieval system