KEGG   Altererythrobacter epoxidivorans: AMC99_01173
Entry
AMC99_01173       CDS       T04070                                 

Definition
(GenBank) Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00010  Glycolysis / Gluconeogenesis
aep00020  Citrate cycle (TCA cycle)
aep00260  Glycine, serine and threonine metabolism
aep00280  Valine, leucine and isoleucine degradation
aep00310  Lysine degradation
aep00380  Tryptophan metabolism
aep00620  Pyruvate metabolism
aep00630  Glyoxylate and dicarboxylate metabolism
aep00640  Propanoate metabolism
aep01100  Metabolic pathways
aep01110  Biosynthesis of secondary metabolites
aep01120  Microbial metabolism in diverse environments
aep01200  Carbon metabolism
Module
aep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMC99_01173
   00020 Citrate cycle (TCA cycle)
    AMC99_01173
   00620 Pyruvate metabolism
    AMC99_01173
   00630 Glyoxylate and dicarboxylate metabolism
    AMC99_01173
   00640 Propanoate metabolism
    AMC99_01173
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMC99_01173
   00280 Valine, leucine and isoleucine degradation
    AMC99_01173
   00310 Lysine degradation
    AMC99_01173
   00380 Tryptophan metabolism
    AMC99_01173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aep04147]
    AMC99_01173
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AMC99_01173
Exosome [BR:aep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AMC99_01173
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA NAD_binding_8 FAD_oxidored FAD_binding_3 HI0933_like Thi4 K_oxygenase 2-Hacid_dh_C 3HCDH_N
Other DBs
NCBI-ProteinID: ALE16469
UniProt: A0A0M5KYH0
LinkDB
Position
1121669..1123081
AA seq 470 aa
MSDQYDVIVLGSGPGGYVAAIRCAQLGLKTAIVERELLGGICLNWGCIPTKALLRSAEIL
HYAQHASDYGLKIAGKIEADLEAVVKRSRGVAKQLNQGVTHLMKKNKITVHMGTGTLTGP
TSLTVKSDKGEEKLTAKHVIVATGARARNLPFAPADGKRVWTYRHAMTPSEMPKKLLVIG
SGAIGIEFASFYNDMGCDVTVVEMLDRIVPVEDKDVSVFLEKSLTKQGMTIMTGAGVEDI
KVTGSGVKAKIKDKSGKVSETEFSHCITAIGIVPNTENVGLEKLAEMDRGFIQIDPYGRT
KSKGLWAIGDCTPGPWLAHKASHEGVTTAEAIAKELGNKDVHPHPLDRGNIPGCTYCHPQ
IASVGLTEAKAKEAGYEVKAGTFPFIGNGKAIALGEAEGFVKTVFDAKTGELLGAHMVGA
EVTEMIQGFVVGKTLETTEAELMNTVFPHPTISESMHESVLASYGRALHI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtccgaccagtatgacgtcatcgttctcggctccggacccggcggttatgtcgcggcg
atccgctgcgcgcagctgggcctgaagaccgccatcgtcgaacgcgaactgcttggcggc
atctgtttgaactggggctgcattccgaccaaggcgctgctgcgtagcgccgagatcctt
cactacgcccagcacgcgagtgattatggactgaagatcgcgggcaagatcgaggcggac
ctcgaagctgtggtgaagcgcagccgcggcgttgccaagcagctgaaccagggcgtcacg
cacctcatgaagaagaacaagatcaccgtgcacatgggtacgggcacgctgaccgggccg
accagcctgaccgtgaagtcggacaagggcgaggagaagctcaccgccaaacacgtgatc
gtcgccaccggcgcgcgcgcccgcaacctgccgttcgcccctgccgacggcaagcgcgtg
tggacctatcgccatgcgatgacgcccagcgaaatgcccaagaagctgctcgtgatagga
tcgggcgccatcgggatcgagtttgccagcttctacaacgacatgggctgcgatgtgacc
gtggtcgaaatgctcgaccggatcgtgccggttgaggacaaggacgtctccgtcttcctc
gagaagagcctgacgaagcaaggcatgacgatcatgaccggtgcgggtgtcgaagacatc
aaggtcactggcagcggcgtgaaggccaagatcaaggacaagtccggcaaggtctccgaa
accgaattcagccactgcatcactgccatcggcatcgtgccgaatacagagaacgtgggc
ttggaaaagctggccgaaatggaccgcggcttcatccagatcgatccctatggtcgcacg
aagtcgaagggcctgtgggccatcggtgactgcacgccgggaccctggctggcgcacaag
gcgagccatgagggcgtcaccaccgccgaagcgatcgcgaaggagctgggcaacaaggac
gtccacccgcacccgctggatcgcggcaacatcccgggctgcacctattgccacccgcag
atcgccagcgtcggcctgaccgaggcaaaggcgaaggaagctggctacgaggtcaaggcg
ggcacgttcccattcatcggcaatggcaaggccatcgcgctgggcgaggcggaaggcttc
gtgaagaccgtgttcgatgccaagaccggcgaactcttgggcgcgcatatggtcggcgcg
gaagtgacagagatgatccagggcttcgtcgtcggcaagacgctggagacgaccgaggcg
gaactgatgaacaccgtgttcccgcacccgacgatctcggaatcgatgcacgaaagcgtc
cttgctagctacgggcgcgcgctccatatctga

DBGET integrated database retrieval system