KEGG   Altererythrobacter epoxidivorans: AMC99_01203
Entry
AMC99_01203       CDS       T04070                                 

Definition
(GenBank) tRNA:m(5)U-54 MTase gid
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
aep  Altererythrobacter epoxidivorans
Brite
KEGG Orthology (KO) [BR:aep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aep03016]
    AMC99_01203
   03036 Chromosome and associated proteins [BR:aep03036]
    AMC99_01203
Enzymes [BR:aep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase [NAD(P)H-oxidizing]
     AMC99_01203
Transfer RNA biogenesis [BR:aep03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    AMC99_01203
Chromosome and associated proteins [BR:aep03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    AMC99_01203
SSDB
Motif
Pfam: GIDA DAO NAD_binding_8 Pyr_redox_2 FAD_oxidored FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_3 AlaDh_PNT_C Pyr_redox HI0933_like 3HCDH_N
Other DBs
NCBI-ProteinID: ALE16498
UniProt: A0A0M4M7N6
LinkDB
Position
1154057..1155451
AA seq 464 aa
MALEMTEHTDHDVHIIGGGLAGSEAAWQLARRGFKVRLSEMRGSGEMTPAHQTDGLAELV
CSNSFRSDDSDKNAVGLLHHEMRALDSLVMSAGEKARVPAGSAMAVDRDVFSSEVQRTLE
EHPNVTVVRERVDSLPASGATIVATGPLTAQSLAQSIVSATGQDRLAFFDAIAPIVHRDS
IDMSKCWIQSRWNKRTEASNEDGDYINCPMTKEQYLAFHQGLMDGEKTEFREWEADTPYF
DGCMPIEVMAARGVETLRYGPMKGVGLDNPYDTTEEHPQGRWPYAVVQLRQDNKLGTLWN
MVGFQTKLKYGAQIELFRTIPGLENAEFARLGGLHRNTFINSPLVLDRQLRLRGGEHIRF
AGQITGCEGYVESSAVGLIAGMMAASELAGRDWTPPPRTTALGSLLSHITGDAEAETFQP
MNVNFGLFPPLHEVKKKQRKEAYTSRAKEDLRMWVAEAEALPAT
NT seq 1395 nt   +upstreamnt  +downstreamnt
gtggcgctcgaaatgacagaacataccgatcacgacgtgcacattatcggcggcggcctc
gctggcagcgaggctgcgtggcaacttgcccggcgagggtttaaggtccgcctttccgaa
atgcgcggaagcggggaaatgacccctgcccaccagacagacggccttgcagaactcgtc
tgttcgaacagcttccgctccgacgatagcgacaagaacgccgtcggattgctacaccac
gaaatgcgcgcgctcgacagcctcgtgatgagcgctggcgaaaaggcacgcgtaccggcg
ggtagtgcgatggcggtggaccgcgacgtcttttcatccgaagtacaacgaacactggaa
gagcatcccaatgttaccgtggtgcgagagcgggtggactccctgcccgcctccggcgcg
accattgtcgccaccggccccctcaccgcgcaatcgctcgcgcagagcatcgtaagtgca
accggccaggaccggctcgcctttttcgatgccattgcccccatcgtccaccgcgacagc
atcgacatgtcgaaatgctggatccagagccgctggaacaagcgcaccgaggcctcgaac
gaggacggcgactacatcaactgccccatgacgaaagagcagtacctcgcgttccaccag
gggctgatggatggcgagaagaccgaatttcgcgaatgggaagcggacacaccctatttc
gatggctgcatgccgatcgaggtcatggccgcacgcggcgtcgaaacgctgcggtacggt
ccgatgaagggcgtcggtctcgacaacccctatgacacgaccgaggaacacccgcagggc
cgctggccctacgctgttgtgcagctgcgccaggacaacaagctcggcacgttgtggaac
atggtcggcttccagacgaagctgaaatacggcgcccagatcgagctgttccgtaccatt
ccggggctcgagaatgccgagttcgcaaggcttggcgggctgcatcgcaatactttcatc
aattcgcctctcgtactcgaccggcagttgagacttcgcggtggcgaacacatccgcttc
gccggccagatcaccggctgcgaaggttatgtcgaaagctctgcagtcggcctgattgcg
ggcatgatggcggcaagcgaattggcaggccgtgactggaccccgccgccgcgcaccacc
gcgctcggctccttgctgagccacattaccggcgacgccgaggcagagacgttccagccc
atgaacgtcaatttcggcctgttcccacccctgcacgaagtgaagaaaaagcagcgcaag
gaagcctatacttcgcgcgcaaaagaggacttacgtatgtgggtagctgaagccgaggct
ctgcccgcgacctga

DBGET integrated database retrieval system