KEGG   Altererythrobacter epoxidivorans: AMC99_01412
Entry
AMC99_01412       CDS       T04070                                 

Definition
(GenBank) Thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMC99_01412
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     AMC99_01412
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 HI0933_like NAD_binding_8 DAO GIDA Thi4 Pyr_redox NAD_binding_9 NAD_binding_7 Lycopene_cycl 2-Hacid_dh_C FAD_binding_3 IlvN FAD_oxidored Trp_halogenase
Other DBs
NCBI-ProteinID: ALE16706
UniProt: A0A0M3TAH1
LinkDB
Position
1373012..1373920
AA seq 302 aa
MDDCIIVGAGPAGLTAAIYLARYRLDIRLFDCGTSRASWIPTSHNHAGFPDGINGEELLE
RMREQAAKYGALREPKRVTDLRKDGDCFIVSCDDEVFEASTVLLATGVVNNRPDGIDDQL
HDEAMSRGLIRYCPVCDGYEVTDKRVAVIGTGDHGTAEAQFIRGFTADLTLVSPNGDHDL
SETCSRALDDAGIARVAGPCGGFAIEGERIAFDTADGRMSFDSLYPALGSLVRSGLARSC
GAEVGENDCIRVDDHLETSVPGLFAAGDVVIGLDQISHAMGQAGVAATTIRNHLAETRPL
RR
NT seq 909 nt   +upstreamnt  +downstreamnt
gtggacgactgcattatcgttggcgcggggcctgcgggcctgaccgcagcgatatacctt
gcacgctatcgcctcgatatccggcttttcgactgcggcaccagccgcgcgagttggatc
ccgacgagccacaatcatgctggctttcccgacgggatcaatggcgaggaactgctggaa
agaatgcgcgaacaggccgcgaaatatggcgcattgcgcgaaccgaagcgtgtcaccgat
ctcaggaaagacggcgactgcttcatcgtatcctgcgatgacgaagtgttcgaggcaagc
actgtcctgctcgcaaccggggtggtgaacaataggcccgacgggatcgacgaccagctg
catgatgaagccatgtcgcgcggcctgatccgctattgcccggtgtgcgacggttacgag
gttacggacaagcgtgtcgcggtcatcggcaccggagatcacggcacggcagaggcgcaa
ttcatccgcggcttcaccgcagacctcaccctcgtctccccgaatggagaccacgatctg
agtgaaacttgttcaagggcgctggacgatgccggaattgcccgggtcgcggggccatgc
ggcggcttcgcgatcgagggcgaacggatcgcattcgataccgccgacggccgcatgtct
ttcgactcgctctaccccgcgctcggatcgttggtccgctccggcctcgcccggtcttgc
ggggccgaggtcggagaaaacgactgcatcagggtggacgatcacctggagaccagcgtc
cccgggctattcgcagcgggtgacgtcgtgatcgggctggaccagatcagccatgcgatg
ggacaggcaggcgtcgccgccaccacgatccgcaaccacctggccgaaacgcgcccgctc
aggcgctag

DBGET integrated database retrieval system