KEGG   Altererythrobacter epoxidivorans: AMC99_01861Help
Entry
AMC99_01861       CDS       T04070                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00473  D-Alanine metabolism
aep00550  Peptidoglycan biosynthesis
aep01100  Metabolic pathways
aep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aep00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMC99_01861
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMC99_01861
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AMC99_01861
Enzymes [BR:aep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMC99_01861
Peptidoglycan biosynthesis and degradation proteins [BR:aep01011]
 Precursor biosynthesis
  Amino acid ligase
   AMC99_01861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALE17149
UniProt: A0A0M5KYS6
LinkDB All DBs
Position
complement(1799368..1800315)
Genome map
AA seq 315 aa AA seqDB search
MGGWANERPVSLMSGNGVADALESRGHKVTRIDMDRKVAQRIAEVAPDVVFNALHGVPGE
DGTVQGMLDLMGVPYTHSGLATSVIAIDKELTKQALVPHGVPMPGGRIVQCVDLFDRDPL
PRPYVLKPVNEGSSVGVAIVTDDSNYGNPIARDAKGPWQDFKQLLAEPFIKGRELTTAVL
DGPEGPRALGVTELVIETGFYDFDHKYTDGMTTHICPAQIPENIAALCREYAVKAHKLLG
CHGVSRTDFRWDDELGEDGLFVLETNTQPGMTPLSLVPEQARLIDMDYADIVEAIVAEAM
RVHADTPSGGGDGDD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggtggttgggccaacgaacgccccgtctccctgatgagcggcaatggcgttgccgat
gctctcgagagccgcggccacaaggtcacgcggatcgatatggaccgcaaggtcgcgcag
cgcatcgccgaggttgcgcccgacgtcgtgttcaacgcgctccatggcgtcccgggcgaa
gatggcacggtgcagggaatgctcgacctgatgggtgtgccctatactcattcgggccta
gcgacttcggtcattgccatcgacaaggaactgacgaagcaggcgctcgtcccgcacggc
gtccccatgccgggtggacgcatcgtccagtgtgtcgacctgttcgaccgcgatcccctg
ccgcgcccttacgtcctgaagccggtcaacgaagggtcttctgtcggcgtcgcgatcgtc
accgacgacagcaattacggcaatccgatcgcacgcgatgcgaagggtccgtggcaggac
ttcaagcagttgctcgccgaacctttcatcaagggtcgcgaactgacgacggccgtgctc
gacgggcccgaagggccgcgcgcgttgggcgttaccgaactcgtcatcgaaaccggattc
tacgatttcgaccacaagtataccgacgggatgacgacccacatctgccccgcgcagatc
cctgaaaacatcgccgccctgtgccgcgaatatgcggtgaaagcacacaagctgctcggc
tgtcacggggtgagccgcaccgatttccgctgggacgacgaacttggcgaggatggcctg
ttcgtccttgaaaccaatacgcagccgggcatgacccctctcagcctggtgcccgaacag
gcgcggctgatcgacatggattatgccgatatcgtcgaagcgatcgtcgcagaagcaatg
cgcgtccacgccgacacaccatcgggaggcggcgatggcgacgattaa

DBGET integrated database retrieval system