KEGG   Altererythrobacter epoxidivorans: AMC99_02420
Entry
AMC99_02420       CDS       T04070                                 

Definition
(GenBank) Ferredoxin reductase
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
aep00071  Fatty acid degradation
aep00360  Phenylalanine metabolism
aep01100  Metabolic pathways
aep01120  Microbial metabolism in diverse environments
aep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMC99_02420
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AMC99_02420
Enzymes [BR:aep01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     AMC99_02420
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox NAD_binding_8 Pyr_redox_3 GIDA DAO HI0933_like FAD_binding_2 FAD_binding_3 FAD_oxidored UDPG_MGDP_dh_N TrkA_N AlaDh_PNT_C Amino_oxidase NAD_binding_7 3HCDH_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ALE17695
UniProt: A0A0M4MVH0
LinkDB
Position
2395654..2396883
AA seq 409 aa
MKQADVVIVGTGHGGAQAAIALRQQGHEDSILMIGRDRELPYERPPLSKEYLAGDKPFER
IMIRPEKFWTEKNVEFRQGEAVTEVDWMAHEVVLSGGDRVGYRKLIWSGGGDPRRLSCAG
ANLKGVHCVRDKSDVDAVMAQLENGANRAVVIGGGYIGLEAAAVLRKLGCDVVLLEALPR
VLARVAGEDLSTFYQEEHRRQGVDLRLETTVEAIEGSDGQVTGVRVAGGEVVPCDMVIVG
IGIVPSVAPLIAAGAAGSNGVDVDVYCRTTLDDIYAIGDCAAHANPFADQAVIRLESVQN
ANDMANTVARAIMGDKQPYHALPWFWSNQYDLKLQTAGLNLDYDDAVLRGDPAERKFTVV
YLKEGRPIAFDCVNSVKDYVQGRKLLENGVGVVDRETLANPDIPLKELL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaaacaggcagatgtcgtcatcgtgggtacgggccacggcggggcgcaggcagcgatt
gcgctgcggcaacaggggcacgaggattcgatcctcatgatcggtcgcgaccgtgagctt
ccctacgaacgcccgccgctgtcgaaggaatatctcgccggcgacaagccgttcgagcgg
atcatgatccgtccggaaaagttctggaccgaaaagaacgtcgagttccgccagggcgaa
gccgtgaccgaagtggactggatggcgcacgaggtcgtgctgtcgggcggcgaccgggtc
ggataccgcaagctgatctggagtggcggcggcgacccgcgccggctttcttgcgccggg
gcgaatctcaagggcgttcattgcgtgcgcgacaagagcgacgtcgatgccgtgatggcc
cagctggaaaatggtgcaaatcgcgccgtcgtcatcggcggcggctatatcgggctcgaa
gcggctgctgtccttcgcaagctcggctgcgacgtcgtcctgctcgaagcgctcccgcgc
gttcttgcgcgcgttgcaggcgaagacctttccacattctatcaggaagaacaccggcgc
cagggcgtcgacctgcggctcgagaccacggtggaagccatcgagggatccgacggccag
gtcacgggtgtccgcgtggctggcggggaagtggtcccttgcgacatggtcatcgtcggg
atcgggatcgttccttcggtggcgccgctgattgcagcaggggcggcaggatcgaacggc
gtcgatgtggatgtctattgccgcactaccctcgacgacatctacgccatcggcgactgc
gctgcgcacgccaatccctttgccgaccaggccgtcatccgtctggaatcggtccagaac
gccaacgacatggccaacacggttgcccgcgcgatcatgggggacaagcagccatatcac
gcgctgccgtggttctggtcgaaccagtacgatctcaagctgcagacggcggggctcaac
ctcgattacgacgacgcggtcctgcggggcgatcctgccgaacggaagttcacggtcgtt
tatctgaaggaaggacgaccgatcgccttcgactgcgtcaattcggtgaaggattacgtc
cagggccgcaagctgctcgaaaacggtgtcggcgtggtcgatcgggaaacgctcgccaat
cccgatattcccttgaaagaacttttgtaa

DBGET integrated database retrieval system