KEGG   Altererythrobacter epoxidivorans: AMC99_02551
Entry
AMC99_02551       CDS       T04070                                 

Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
aep  Altererythrobacter epoxidivorans
Brite
KEGG Orthology (KO) [BR:aep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aep03016]
    AMC99_02551
   03036 Chromosome and associated proteins [BR:aep03036]
    AMC99_02551
Transfer RNA biogenesis [BR:aep03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    AMC99_02551
 Prokaryotic type
    AMC99_02551
Chromosome and associated proteins [BR:aep03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    AMC99_02551
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_9 AlaDh_PNT_C FAD_binding_2 HI0933_like DAO
Other DBs
NCBI-ProteinID: ALE17824
UniProt: A0A0M5KZ35
LinkDB
Position
2515621..2517492
AA seq 623 aa
MRNYDIVVVGGGHAGVEAACGAARMGARVALVSFDLAAIGAMSCNPAIGGLGKGHLVREV
DALDGVIGRAADAGAIHYRMLNRSKGSAVWGPRVQADRVLFKAAVQAIVRSQPNLELVEG
EAAAIAFDKDRVSGLELANGETLGAGAVILCTGTFLGGVLFRGEERFEGGRIGENAARRL
AEQLRAANLPMSRLKTGTPPRLDGRTIDWASLEEQPSDPDHWTMSPLTGERVNPQVFCAI
TRTTQAAHDVIRANLDRSPLFSGAIDARGPRYCPSIEDKIHRFGDREGHQVFLEPEGLST
HLVYPNGISTSLPTDVQLAMLRAMPGLERVKMEVPGYAVEYDHIDPRALGADLQLREIPG
LYCAGQINGTTGYEEAAAQGLVAGLHAAAGVAGKEAPKLDRSNSYIAVMVDDLTLQGVSE
PYRMLTARAEYRLRLRANNASTRLTPLGIEAGCIGDARKAWFEAREGQRGAIDIVLDQKI
PAKVLADAGMPVRRDGGEKPIREWVRHDGLSFTALREYSGHATDDVRDQALLGEMVEDAI
YAPYLARQEAELRDLRASEALTLGADFPYEDVPGLSNEMLERLSSAKPPTLAAAGRIPGI
TPAALSALLVHAKRRVLNSERAA
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgcgaaattacgacatcgtagttgtcggcggcggacatgccggcgtcgaggcggcctgt
ggtgctgcccgtatgggcgcacgcgtcgcgctggtcagctttgacctcgccgctatcggc
gcgatgagctgcaacccggcgattggcgggctggggaagggccacctcgtccgcgaagtc
gatgcgctcgacggcgttatcgggcgggcggcggatgctggcgccattcactatcggatg
ctcaatcgctccaaaggaagcgcggtctggggcccgcgggtccaggcggaccgggtcctg
ttcaaggcggcggttcaggcaatcgtccgttcgcagcccaatctcgaactggtcgagggt
gaggctgcggctatcgcgttcgacaaggatcgcgtatccggtctcgagctcgctaacggc
gaaaccctcggcgccggtgctgttattctatgcacgggcactttccttggcggcgtgctt
ttccgcggggaagagcggtttgaaggggggcgtatcggggagaacgctgcgcgacggctc
gccgagcaattgcgggcggcaaatcttcccatgtcacgcctcaagacggggacgccgccg
cggctggacggccgcacgatcgactgggcttcgctcgaagagcaaccttccgatcccgat
cattggacaatgtcgccgctaaccggagagcgcgtgaatccgcaggtgttttgtgcgatt
acgcgcacgacgcaggcggcccacgacgtaatccgcgccaatctcgatagatcaccgctg
ttttccggagcgatcgacgctcgtggaccgcgttactgcccgtctatcgaggataagatc
catcggtttggcgaccgtgaagggcatcaggtctttcttgagccagagggactttcgacc
catctggtctatcccaatgggatcagcacctcgctgccgaccgacgtgcagctcgcgatg
ctgcgtgcgatgccggggcttgagagggtcaaaatggaggtcccgggttatgcggtcgag
tacgaccacatcgatccgcgtgccctgggcgccgacttgcaactccgtgaaattcccgga
ctttattgtgcggggcaaatcaacggcactacggggtatgaagaggcggcggcgcagggg
ctcgttgcaggccttcatgcggcggctggtgtggccggtaaggaggctccgaaactcgac
cgttcgaattcctacatcgccgtcatggtcgacgatctcacgctgcagggggtttcggaa
ccctatcgtatgctgaccgcccgtgccgagtatcgcctgcgcctccgcgccaataatgca
tcgacgcgcctgacgccgctcggaatcgaagctggctgcattggcgatgcccgcaaagcg
tggtttgaggcgcgggaagggcaacgtggcgcgatcgacatcgtcttggaccagaagata
ccagccaaggttctggcagatgcaggaatgcctgtacgccgcgatggaggtgagaaaccc
atcagggagtgggttcgtcacgacggtctctctttcaccgcccttcgtgagtattctggc
cacgcaaccgatgatgtgcgggaccaggcactgctgggtgaaatggtcgaagatgcgatc
tacgcgccatatctcgcgcgccaggaggctgaactacgtgaccttcgcgcaagcgaggcg
ctgaccctgggtgctgactttccgtacgaagatgtaccgggtctctccaacgagatgctt
gaacgtctttcctcggcaaagcccccgacgctcgcagccgcgggacgaattcccggcatc
acccccgccgcgctatcggccttgctcgtccatgcaaagcgccgagttttgaattcggag
cgggctgcatga

DBGET integrated database retrieval system