KEGG   Adlercreutzia equolifaciens: AEQU_0592Help
Entry
AEQU_0592         CDS       T02875                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
aeq  Adlercreutzia equolifaciens
Pathway
aeq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aeq01100  Metabolic pathways
aeq01110  Biosynthesis of secondary metabolites
aeq01130  Biosynthesis of antibiotics
aeq01230  Biosynthesis of amino acids
Module
aeq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aeq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AEQU_0592
Enzymes [BR:aeq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     AEQU_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: BAN76561
LinkDB All DBs
Position
802044..803165
Genome map
AA seq 373 aa AA seqDB search
MPATKIVVNIPGETPYDVRIGATVLAGLGESVRRLDGVGDAPHLLVLTDSNVGPLYLEEA
KSSLKAAGFRVSDIVVPAGEDSKSLAVAGEIWSAMASLGLTRDCAVVALGGGVVGDLAGF
VASTYMRGIPFVQVPTSLLAMVDSSVGGKTGVNLPEGKNLVGTFKQPAYVCASTAVLATL
DAREWACGCAEIAKASVIDSDEFFFWMMDHASALEARDPVVVTEAIARSVVFKANIVAED
KTESRGVRECLNYGHTLGHAVEALAGYGTFSHGAAVAEGMRFAARLGVDVVGTSAELVDA
QDELLDGLGLPALGWSAPADEMLAAMKRDKKTRAGEVRFVLPRDIGDWELVAVPDDVILE
HLRRWEASKNSLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcaacaaagatagtggtcaacatccccggcgagacgccctacgacgtgcgcatc
ggcgctacggtgctcgccggcctcggcgagtcggtgcggcggctcgatggcgtgggagac
gcgccgcacctgctcgtcctcaccgattccaacgtggggccgctgtatctggaagaggcc
aagtcgtcgctgaaggcggcgggcttccgcgtgagcgatatcgtcgtgcccgcgggggag
gactcgaagtcgctcgcggtggccggggagatctggtcggccatggcatcgctcgggctc
acgcgcgactgcgccgtggtggccctcggcggcggcgtcgtgggcgacttggctgggttc
gtcgcctctacctacatgcggggcatcccgtttgtgcaggtgcccacttcgcttctggcc
atggtggattcctcggtcggcggcaagaccggcgtgaaccttcccgaggggaagaacctc
gtgggcacgttcaagcagccggcctacgtgtgcgcctccacggcggtgctcgccacgctg
gacgcgcgcgagtgggcctgcggctgcgccgagatcgccaaggcgtcggtgatcgattcc
gacgagttcttcttctggatgatggatcatgccagcgccctggaggcgcgcgatccggtg
gtggtcaccgaggccatcgcgcggtcggtggtgttcaaggccaacattgtggccgaggac
aagacggagagccgtggggtgcgcgagtgcctgaactacgggcacactctgggacatgcg
gtggaggcgctcgcgggctatgggacgttctcccatggggccgccgtggccgagggcatg
cgcttcgcggcgcgcctcggcgtggatgtggtgggcacgtcggccgagctggtggatgcc
caggacgagcttctggacgggctcgggctgccggcgcttggctggtcggcgccggccgat
gagatgctggccgccatgaagcgcgacaagaagacccgcgccggcgaggtgcgcttcgtg
ctgccccgcgacatcggcgactgggaactggtggcggtgcctgacgatgtgattttggag
catctgcgacggtgggaggcttccaagaactcgttacgttga

DBGET integrated database retrieval system