KEGG   Adlercreutzia equolifaciens: AEQU_2193Help
Entry
AEQU_2193         CDS       T02875                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aeq  Adlercreutzia equolifaciens
Brite
KEGG Orthology (KO) [BR:aeq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aeq01001]
    AEQU_2193
Enzymes [BR:aeq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AEQU_2193
Protein kinases [BR:aeq01001]
 Serine/threonine kinases: Other
  Bacterial family
   AEQU_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 KIND Marek_A Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAN78162
LinkDB All DBs
Position
2738198..2740120
Genome map
AA seq 640 aa AA seqDB search
MTGQGTMTGKVFGGRYEIKDRIGIGGMAEVYRAQDSTLGRVVAVKVMLPQFAADPSFTQR
FRQEAAAAANLQSPYIVNVYDWGQDDDTYYIVMEFVRGSDLKTAIQQRGAINQRKAAEIG
AQVCQALTVAHNQDIIHRDIKPQNIMVQPDGNVKVMDFGIARAKNSVNDKTSAVLGTAHY
ISPEQAQGKDLTAASDIYSLGIVLYEATTGKLPFDGPDAVSVAMQQVKDEPAAPSSINPN
IDPDLEDIIMVALSKDPARRFATANDMRIALNDYLAGRPVTLPAGAMSSSFTEAQTRMMG
AVPAPVPGITSTQVMPTVAGGTAAMSPSSTGNFQATNFHDANTKKSKKPVIIALCAILAI
ALVAGIAFAVSGGFKPAAPADEPIEVPSVVGNTLDEATFTLEQAGFQVTTTPKEDESVDE
GTVLQQDPAGGTKQPKGTTITLTIAVGPDTVDAPNFKNMTMDEARQAAEDAGLKVVEAES
KYSEDVAEGKIISQSPAADEPVKPGTTIEVVTSRGSELTTVPNVIGMTEEKAIDKLQSEG
FGADVKAREYSDKQGEGRVMKQDPLNDKVKPGATVQITISKGPEPEPEPDPKPEQPTNPG
ATDPGTNNPGGTTDPGTTDPGTTDPGNQGGDTGTTTPSTN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggacagggaacaatgacgggcaaggtcttcggcggccgctacgagataaaggat
cgcatcggcatcggcggcatggccgaggtgtaccgcgcccaagatagcacgctgggccgc
gtcgtcgccgtgaaggtgatgctgccccaattcgccgccgacccctctttcacccagcgc
ttccgccaggaagccgccgcggctgcaaacctgcagagcccctacatcgtgaacgtgtac
gactggggccaagacgacgacacctattacatcgtcatggagttcgtgcgcgggtccgac
ctgaagaccgccatccagcagcgcggcgccatcaaccagcgtaaggccgccgaaatcggc
gcccaggtgtgccaggccctcaccgtcgcccacaaccaggacatcatccaccgcgacatc
aagccgcagaacatcatggtgcagcccgatggcaacgtgaaggtgatggatttcggcatc
gcccgagcgaagaattccgtgaacgacaaaacgtccgctgtgctgggcaccgcccactac
atctcgccggaacaggcccagggcaaagatctcacggccgccagcgacatctactcgctg
ggcatcgtgctgtacgaggccaccacgggcaagctccccttcgatggcccggacgccgta
tcggtagccatgcagcaggtgaaggacgagccggccgcgccctcttccatcaacccgaac
atcgaccccgacctcgaggacatcatcatggtggccctctcgaaggatccggcgcgccgc
ttcgccacggccaacgacatgcgcatcgcactgaacgactacctggccggacgccccgtc
acgctgcccgccggcgcgatgagctcgtcgttcaccgaggcccagacgcgcatgatgggc
gccgtgcccgctcccgtgccgggcatcacgagcacccaggttatgccgacggttgccggc
ggcacagcggccatgtcgccgagttccacgggcaatttccaagcgacgaacttccacgac
gccaacacgaagaagagcaagaagcccgttatcatcgccctctgcgccattttggccatc
gcgctggtggccggcatcgccttcgccgtgtccggcggcttcaagccggctgcccctgcc
gacgagcccatcgaggtgcccagcgtggtgggcaataccttggacgaggcgacattcacc
ctggagcaagcgggcttccaagtaactaccactcctaaggaagacgaatccgtcgacgag
ggcaccgtgctgcagcaagatccggccggcggcaccaagcagccgaagggtacgaccatc
accctcaccattgccgtggggcccgataccgtggacgcgcccaacttcaagaacatgacc
atggacgaggcgcgccaggcggccgaggacgccggccttaaggttgtggaagccgagagc
aaatactcggaagatgtcgccgagggcaagatcatttcgcaaagccccgccgccgacgag
ccggtgaagcccggcaccaccatcgaggtcgtcacctcccgcggaagcgagctgacgacc
gtgcccaacgtcatcggcatgaccgaggagaaggccatcgacaagctgcagtccgagggc
ttcggtgccgacgtgaaggcccgcgagtacagcgacaagcagggcgagggccgcgtcatg
aagcaggatccgctgaacgacaaggtgaagcccggcgctaccgtgcagatcaccatttcg
aagggccccgagccggagcccgagcccgaccccaagccggagcagcccaccaaccccggc
gcgaccgaccccggcaccaacaatcctggtggcaccaccgatccgggcacgaccgacccc
ggcaccaccgacccgggcaaccagggcggcgacaccggcaccaccaccccttccaccaac
tag

DBGET integrated database retrieval system