KEGG   Aeromicrobium erythreum: AERYTH_03940Help
Entry
AERYTH_03940      CDS       T04236                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00020  Citrate cycle (TCA cycle)
aer00480  Glutathione metabolism
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
aer01120  Microbial metabolism in diverse environments
aer01130  Biosynthesis of antibiotics
aer01200  Carbon metabolism
aer01210  2-Oxocarboxylic acid metabolism
aer01230  Biosynthesis of amino acids
Module
aer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aer_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AERYTH_03940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AERYTH_03940
Enzymes [BR:aer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AERYTH_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALX03911
UniProt: A0A0U3TEE6
LinkDB All DBs
Position
808148..810364
Genome map
AA seq 738 aa AA seqDB search
MAKIIYTHTDEAPLLATYSFLPVIEAFASTAGVEVETRDISLSGRILAAFADVLPADQKV
DDALAELGALAKTPEANIIKLPNISASIPQLKAAVKELQEQGFDLPAYPDNPTSDAEKDT
KARYDKVKGSAVNPVLREGNSDRRAPASVKAYARKNPHSMGAWSSDSKTEVATMGADDFR
SNEKSVVLDADDTLTIQHVATDGSTTVLKDGLKVLAGEVVDATVMRAAALDTFLAEQVQR
AQDLDVLFSVHLKATMMKVSDPIIFGHVVRAYFADVFAQYGDDLAAAGLSANDGLGGILS
GLDALDNGAEIKAAFEQRLAEGPRLAYVDSDKGITNLHVPSDVIVDASMPAMIRTSGHMW
GADGQEHDTLAVIPDSSYAGVYQAVVEDCKAHGAYDPTTMGSVPNVGLMAQAAEEYGSHD
KTFEIETAGTVQVVDSSGDVLLEHDVEPHDIWRACQTKDVPIRNWIELAVTRARATGAPA
IFWLDETRAHDANLIAKVNAYLPELDTDGLTIEIMAPAEATTYSVERIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLVKENYLRWDSL
GEFFALAASFEHLATTAGNARAQVLADTLDRATGTFLDEDRSPGRKLGTIDNRGSHFYLA
LYWAEELAKQTEDAELASAFADVAGALRGNEQTIVDELLAVQGSPADIGGYYRPSDEKAE
KVMRPSSTLNEVLGSLSV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcatctacacgcacaccgacgaggccccgctgctggcgacctactcgttc
ctccccgtcatcgaggccttcgcctcgacggccggcgtcgaggtcgagacccgcgacatc
tcgctgtccggtcgcatcctggccgcgttcgccgacgtgctccccgccgaccagaaggtc
gacgacgcgctcgccgagctcggcgcgctggccaagacgcccgaggccaacatcatcaag
ctgcccaacatcagcgcctcgatcccgcagctcaaggccgcggtcaaggagctgcaggag
cagggcttcgacctccccgcgtacccggacaacccgaccagcgacgccgagaaggacacc
aaggcgcgctacgacaaggtcaagggcagcgccgtcaacccggtgctccgcgagggcaac
tccgaccgccgcgcccccgcgtcggtcaaggcctacgcccgcaagaacccgcactccatg
ggtgcctggagcagcgactccaagaccgaggtcgccaccatgggcgccgacgacttccgc
tccaacgagaagtccgtcgtcctcgacgccgacgacaccctcaccatccagcacgtcgcc
accgacggcagcaccaccgtcctcaaggacggcctgaaggtcctcgccggcgaggtcgtc
gacgccaccgtcatgcgcgccgccgccctcgacaccttcctcgccgagcaggtccagcgc
gcccaggacctcgacgtcctgttctcggtgcacctcaaggccaccatgatgaaggtctcc
gacccgatcatcttcggccacgtcgtgcgcgcctacttcgccgacgtgttcgcgcagtac
ggcgacgacctcgctgcggccggcctcagcgccaacgacggcctgggcggcatcctctcc
ggtctcgacgcgctcgacaacggcgccgagatcaaggcggccttcgagcagcgcctcgcc
gagggaccgcgcctcgcctacgtcgactccgacaagggcatcacgaacctgcacgtgccg
agcgacgtcatcgtcgacgcgtcgatgcccgccatgatccgcacgtcgggccacatgtgg
ggcgcggacggccaggagcacgacaccctcgccgtcatcccggactccagctacgccggc
gtctaccaggccgtcgtcgaggactgcaaggcgcacggcgcctacgacccgaccacgatg
ggctcggtgcccaacgtcggcctcatggcgcaggcggccgaggagtacggcagccacgac
aagaccttcgagatcgagacggccggcacggtgcaggtcgtcgactcctccggcgacgtg
ctcctcgagcacgacgtcgagccgcacgacatctggcgcgcctgccagacgaaggacgtg
ccgatccgcaactggatcgagctcgccgtcacgcgggcccgcgccaccggcgcccccgcg
atcttctggctcgacgagacccgcgcccacgacgcgaacctcatcgccaaggtcaacgcc
tacctgcccgagctcgacaccgacggcctcacgatcgagatcatggcgccggccgaggcg
accacctactcggtggagcgcatccgtcgcggcgaggacaccatcagcgtcaccggcaac
gtgctgcgcgactacaacaccgacctgttcccgatcctggagctgggcacgagcgcgaag
atgctctccgtcgtcccgctgatcaacggcggtggactgttcgagaccggtgcgggcggt
tccgcgccgaagcacgtgcagcagctcgtcaaggagaactacctgcgctgggacagcctc
ggcgagttcttcgcgctggcggcgagcttcgagcacctggccaccacggccggcaacgcg
cgcgcccaggtgctcgccgacacgctcgaccgcgccaccggcaccttcctcgacgaggac
cgctcgccgggccgcaagctcggcacgatcgacaaccgcggcagccacttctacctcgcc
ctctactgggccgaggagctggcgaagcagaccgaggacgccgagctggcgtccgcgttc
gccgacgtcgcgggtgcgctgcgcggcaacgagcagacgatcgtcgacgagctgctcgcc
gtccagggatcgcccgccgacatcggcggctactaccgtccgtcggacgagaaggccgag
aaggtcatgcgtccctcgagcaccctcaacgaggtcctcggctcgctcagcgtctga

DBGET integrated database retrieval system