KEGG   Aeromicrobium erythreum: AERYTH_04230Help
Entry
AERYTH_04230      CDS       T04236                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aer  Aeromicrobium erythreum
Pathway
aer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AERYTH_04230
Enzymes [BR:aer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AERYTH_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N AlaDh_PNT_C Pyr_redox NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ALX03964
UniProt: A0A0U4CMN2
LinkDB All DBs
Position
874242..875978
Genome map
AA seq 578 aa AA seqDB search
MRPVPLSPHARQAALDAMEAAPLDVLVIGGGVVGAGAALDAATRGLSVGLVEARDFASGT
SSRSSKLMHGGLRYLEMLDFRLVAEALKERGLNLQKLAPHLVQEVAFLYPLQHRGWERFY
AGSGVALYDAMSKASGYGKGVPLHRHHTRRGARKIFPGLRKDALVGALRYYDAQVDDARH
TMFLARTSAAYGAHVASRTRVVDLLREGGRVVGARLKDLESGRELDVRASVVLNATGVWT
DETQGMAAERGQFHVRASKGIHLVVPRDRIRGEGGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLSKDHPAASRNDIDYLLEHVNRVLVEPLTHADVEGVYAGLRPLLAGEDEATSKLSR
EHAVSTSVKGLVVIAGGKYTTYRVMAKDAVDAAVHSMTRQLDRVVPASCTEDVPLLGADG
FEALWNQRHRLAADSGLSVARIEHLLRRYGSLVVEVLDLVTTDATLGEPLGGADDYLRAE
VVYGTTHEGARHLDDVIARRTRISIETFDRGTEVAREVADLMGDALGWTGEQRDVEVEHY
LKRVAAERESQTMPDDETADAARMGAPDVVPVATADTP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgtccctctctcgccccacgcccgccaggccgccctcgacgcgatggaggcc
gccccgctcgacgtcctggtcatcgggggaggagtcgtcggcgccggcgccgccctcgac
gccgccacccgcggtctctcggtcggtctggtcgaggcgcgcgacttcgcgtcgggcacg
tcgagccggtccagcaagctcatgcacggcggcctgcgctacctggagatgctcgacttc
cggctcgtcgccgaggcgttgaaggaacgcgggctgaacctgcagaagctcgcgccgcac
ctcgtgcaggaggtggccttcctgtacccgctgcagcaccgcggctgggagcgcttctac
gccgggtccggcgtcgcgctgtacgacgcgatgagcaaggcgtccggctacggcaagggc
gtgccgctgcaccgccaccacacccgccgcggggcgcgcaagatcttccccggcctgcgc
aaggacgcgctcgtcggcgcgctgcgctactacgacgcccaggtcgacgacgcccgccac
acgatgttcctcgcccgcacgtccgccgcctacggcgcgcacgtcgccagccggacccgc
gtcgtcgacctgctccgcgagggcggtcgcgtggtcggcgcccgcctcaaggacctcgag
tccgggcgcgagctcgacgtccgcgcgtcggtggtgctcaacgcgaccggcgtctggacc
gacgagacgcaggggatggccgccgagcgcggccagttccacgtgcgcgcctccaagggc
atccacctcgtcgtgccgcgcgaccgcatccgcggcgagggcgggctcatcctgcgcacc
gagaagtccgtgctcttcgtcatcccgtggggccggcactggatcatcggcaccaccgac
accgactgggacctctcgaaggaccatccggcggccagccgcaacgacatcgactacctc
ctcgagcacgtcaaccgcgtgctggtcgagccgctgacccacgccgacgtcgagggcgtc
tacgcgggcctgcggccgctgctggcgggcgaggacgaggccaccagcaagctctcgcgc
gagcacgccgtctccaccagcgtcaagggcctcgtggtgatcgcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgctgccgtgcacagcatgacccgccag
ctcgaccgcgtcgtcccggcgtcgtgcaccgaggacgtgccgttgctcggcgccgacggc
ttcgaggcgctctggaaccagcggcaccgtttggccgccgacagcggactctccgtcgcg
cgcatcgagcacctgctgcgacgctacgggtccctcgtcgtcgaggtgctcgacctcgtc
accaccgacgcgacgctcggcgagcccctcggcggcgccgacgactacctgcgcgccgag
gtcgtctacggcacgacccacgagggcgcgcgtcacctcgacgacgtcatcgcccgtcgc
acccgcatctccatcgagaccttcgaccgcggcaccgaggtggcccgcgaggtcgccgac
ctcatgggcgacgcgctggggtggacgggcgagcagcgcgacgtcgaggtcgagcactac
ctcaagcgggtcgccgccgagcgcgagtcgcagaccatgcccgacgacgagacggccgac
gccgcccgcatgggggctcctgacgtcgtgccggtcgccaccgccgacacgccgtga

DBGET integrated database retrieval system