KEGG   Aeromicrobium erythreum: AERYTH_09350Help
Entry
AERYTH_09350      CDS       T04236                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aer  Aeromicrobium erythreum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALX04888
UniProt: A0A0U3T2K2
LinkDB All DBs
Position
complement(1980260..1981357)
Genome map
AA seq 365 aa AA seqDB search
MDLPVMPPLQPMLAKSVKGVPAADAVDGGYLFEPKWDGFRAVVFRDGDEVEIASRSTKPL
TRYFPDVVAAVLAQLPQRCVMDGEIVTAVGDRLDFDTLSQRIHPAASRVAMLAEETPASL
VVFDLLALDGTSYLDAPLHERRAVLEAALADVEAPVHLTRTTRDSAEAGRWFEQFEGAGL
DGVVAKRLDAPYTPNGRTMLKVKHARTADVVVAGYRLHKTSTPEQPLLGSMLLGLYTDDG
RLQHVGVCASFTATRRAELAAELAPLRAELSEHPWGAWQTTQAHEDGRLPGGQSRWTGTK
DLSFVPLRPERVVEVGYEHMEGRGEEGRFRHTAQFKRWRPDREPTSCTYAQLEEVVSYDL
GDVLA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgccgccgctgcagcccatgctcgccaagtcggtcaagggggtg
cccgccgccgacgcggtcgacggcggctacctgttcgagccgaagtgggacgggttccgt
gccgtcgtctttcgcgacggcgacgaggtggagatcgcgagccggtccaccaagcccctg
acccgctacttccccgacgtcgtcgcggcggtgctggcccagctgccgcagcgctgcgtg
atggacggcgagatcgtcacggccgtcggcgaccggctggacttcgacacgctgtcgcag
cgcatccacccggcagcgtcgcgggtggccatgctcgcggaggagacgcccgcgagcctc
gtcgtgttcgacctgctggcgctcgacggcacgtcgtacctggacgcgccgctgcacgag
cgccgtgccgtgctcgaggcggccctcgcggacgtcgaggcgccggtccacctcacgcgc
acgacgcgggacagcgccgaggccggacgctggttcgagcagttcgagggggcgggtctc
gacggggtcgtggcgaagcggctcgacgccccctacacgccgaacggccgcaccatgctc
aaggtcaagcacgcgcgcacggccgacgtcgtggtggccgggtaccggctgcacaagacg
tcgacgcccgagcagccgctgctcgggtcgatgctgctggggctgtacaccgacgacgga
cgcctgcagcacgtcggcgtctgcgcctcgttcaccgcgacgcgccgggccgagctggcg
gccgagctcgcgcccctgcgcgcggagctgtcggagcacccgtggggtgcctggcagacc
acgcaggcgcacgaggacggccggctgccgggcgggcagagccgctggaccggcacgaag
gacctctcgttcgtgccgctgcgcccggagcgcgtggtcgaggtcggctacgagcacatg
gagggccgcggcgaggagggccggttccgccacaccgcgcagttcaagcgctggcgcccc
gaccgggagccgacgtcgtgcacgtacgcccagctcgaggaggtcgtgtcctacgacctc
ggcgacgtgctcgcctag

DBGET integrated database retrieval system