KEGG   Aeromicrobium erythreum: AERYTH_15840
Entry
AERYTH_15840      CDS       T04236                                 

Definition
(GenBank) EryCIV dTDP-4-dehydro-6-deoxyglucose aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00523  Polyketide sugar unit biosynthesis
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AERYTH_15840
Enzymes [BR:aer01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     AERYTH_15840
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5
Other DBs
NCBI-ProteinID: ALX06062
UniProt: Q5Y9I0
LinkDB
Position
complement(3319088..3320293)
AA seq 401 aa
MKRTIDDLAVFGGPAAFLNTVTVGRPSMGDRERFESRMAWVLNNEWLTNSGPLVSEFETA
VAEIAGVRHCVATSNATVGLQLAMHAAGVRGEVIMPAMTFAATPHAASWIGLEPVFCDVD
PVTGLIDPDDVKRRITERTGAVVGVHLWGQVAPVEELDRLAHDHGLVMLYDAAHALGCTR
DDRPAGSFGDAEVFSFHATKVVTSFEGGALVTDDAALAARARSMHNFGLGQGGRVEHVGT
NAKMSEASAAMGLTSLDAFAEVCEHNRRNHELYAEELRGVKGLRLHELDLEERSNYQYVI
VSVDPAHTGIDRDEIIRVLAAEQVVAKPYFSPPCHLMEPYRTETPQRIESAEWLAAQVVA
LPTGPGVSAEDIRRICDVLRLVVADGEHVARRLTAARNAPS
NT seq 1206 nt   +upstreamnt  +downstreamnt
gtgaagcgcaccatcgacgacctcgccgtcttcggggggcccgcagccttcctcaacacc
gtcaccgtcggtcgcccttcgatgggggaccgtgagcgcttcgagtcgcgcatggcctgg
gtgctgaacaacgagtggctcacgaacagcggcccgttggtcagcgagttcgagaccgcc
gtcgccgagatcgccggggtcaggcactgcgtggccacgagcaacgccacagtgggcctg
cagctcgcgatgcacgcggcgggggtccgcggcgaggtcatcatgccggccatgacgttc
gcggcgacgccgcacgccgctagctggatcggtctggagccggtcttctgtgacgtcgac
ccggtcacggggctgatcgaccccgacgacgtgaagcggcgcatcaccgagcgcaccggg
gccgtcgtcggcgtccacctgtggggccaggtcgcgccggtcgaggagctcgaccgactc
gcgcacgaccacggcctggtcatgctctacgacgccgcccacgccctggggtgcacgcgc
gacgaccggccagcgggcagcttcggcgacgccgaggtcttcagcttccacgcgaccaag
gtggtcacgtccttcgagggcggggccctggtcaccgacgacgccgcgctcgccgcgcgg
gcccggagcatgcacaacttcggcctcggccagggcggacgggtggagcacgtcggcacc
aacgcgaagatgagcgaggcgtcggccgccatgggcctcacctcgctcgacgcgttcgct
gaggtctgcgagcacaaccgccgcaaccacgagctgtacgccgaggagctgcgcggcgtg
aagggcctgcggctgcacgagctcgaccttgaggagcgcagcaactaccagtacgtgatc
gtctcggtggatcccgcgcacaccgggatcgaccgcgacgagattatcagggtgctcgct
gccgagcaggtggtcgcgaagccgtacttctcgccgccgtgccacctcatggagccctac
cggaccgagaccccccagcgcatcgagagcgcggagtggctggcggcgcaggtcgtcgcc
ctgcccaccgggccgggggtctcggccgaggacatccgcaggatctgcgacgtgctgcgg
ctggtcgtcgccgacggggagcacgtcgcgcgccggctgaccgcagcgaggaacgcaccg
agctag

DBGET integrated database retrieval system