KEGG   Aeromicrobium erythreum: AERYTH_15860
Entry
AERYTH_15860      CDS       T04236                                 

Definition
(GenBank) EryK erythromycin C-12 hydroxylase
  KO
K14370  erythromycin 12 hydroxylase [EC:1.14.13.154]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00522  Biosynthesis of 12-, 14- and 16-membered macrolides
aer01052  Type I polyketide structures
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    AERYTH_15860
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    AERYTH_15860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aer01008]
    AERYTH_15860
   00199 Cytochrome P450 [BR:aer00199]
    AERYTH_15860
Enzymes [BR:aer01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.154  erythromycin 12-hydroxylase
     AERYTH_15860
Polyketide biosynthesis proteins [BR:aer01008]
 Polyketide tailoring proteins
  Oxygenase
   AERYTH_15860
Cytochrome P450 [BR:aer00199]
 Cytochrome P450, bacteria type
  CYP113 family
   AERYTH_15860
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ALX06066
UniProt: Q5Y9H6
LinkDB
Position
complement(3323251..3324414)
AA seq 387 aa
MSHVVPPMSDEKALLAWLAEMRAHEPVWRDEYGVWHVFRHADVREVLKDTATFSSDPNRV
IEGSEPTPGMIHEMDPPDHRALRKVVSSAFTPRMVENLEPRVREVARDLLDAAGPRFDLV
QEIAFTLPVTIIGEMLGLPREDQEQFGSWSASLIDIQMDDPTDPALAERIAAILDPLTSY
LQRLCAERRAAPADDLVSKLVLAEVDGRGLDDVEAANFSTALLLAGHVTTTVLLGNIVNT
LDEHPWAWDLAREHPDRIPAIVEEVLRFRPPFPQMQRTTTAPARVGGVDLPADVMVNVWV
LSANRDPEAHKDPDRFDPDRGVRGAAQLSFGHGIHFCLGAPLARLENVVALEEIVRSRGR
LVVDREDPSFAMFDQIVLGVRTMPVHV
NT seq 1164 nt   +upstreamnt  +downstreamnt
gtgtcccacgtggtcccgccgatgtccgacgagaaggccctgctcgcctggctggccgag
atgcgcgcgcacgaaccggtctggcgcgacgagtacggcgtgtggcacgtgttccgccac
gcggacgtccgcgaggtcctgaaggacaccgccacgttctcctccgacccgaaccgggtg
atcgagggctccgagccgaccccggggatgatccacgagatggacccgccggaccaccgc
gcgctgcgcaaggtggtcagcagcgcgttcaccccacggatggtcgagaacctggagccg
cgagtccgcgaggtcgcacgcgatctgctcgacgcggccggaccgcgtttcgacctcgtg
caggagatcgccttcacgctgcccgtcaccatcatcggagagatgctcggcctgccgcgc
gaggaccaggagcagttcggctcctggtcggcctccctcatcgacatccagatggacgac
ccgaccgacccggccctggcggagcgcattgcggcgatcctggatcctctgacgtcgtac
ctgcagcgcctgtgcgccgagcgccgcgccgcgcccgccgacgacctggtgagcaagctc
gtccttgcagaggtggacgggcgcgggctcgacgacgtggaggcggcgaacttctcgacc
gcgctcctcctcgcgggccacgtcaccaccacggtcctgctcggcaacatcgtcaacacg
ctcgatgagcatccctgggcttgggatctcgcccgcgagcacccggaccggatccccgcc
atcgtcgaggaggtcctgcgcttccgtccacccttcccgcagatgcagcgcacgacgact
gccccggcgcgggtcggcggcgtggacctcccggccgacgtcatggtgaacgtgtgggtg
ctgtcggccaatcgcgacccggaggcgcacaaggaccccgatcgcttcgaccccgaccgc
ggggtgcgcggcgcggcgcagctctccttcggccacggcatccacttctgcctcggggca
ccgctcgcgcgcctcgagaacgtcgtcgcgctcgaggagatcgtccggtcccgcggccgg
ctcgtggtcgaccgcgaggacccgtcgttcgcgatgttcgaccagatcgtcctcggggtg
cgcaccatgccggtccacgtctag

DBGET integrated database retrieval system