KEGG   Aeromonas sp. ASNIH5: C2U30_01110Help
Entry
C2U30_01110       CDS       T05873                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aes  Aeromonas sp. ASNIH5
Brite
KEGG Orthology (KO) [BR:aes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U30_01110
Enzymes [BR:aes01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2U30_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AUT40444
UniProt: A0A2I8D0M0
LinkDB All DBs
Position
complement(259185..260771)
Genome map
AA seq 528 aa AA seqDB search
MLDTNLKQQLNGYLQYIVNPIEISVSGNDSDKSAELLALASEIAEMSPKISLTDGTNARK
PSMSIAPQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADPAVLEQVKNLKGEFHFE
TYISLSCHNCPDVVQALNLMSTLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAQELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADDVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEIALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPSPEAQATQADAVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacctcaaacaacaactcaacggttacttgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatccgccgaactcctggcattggcc
agcgagatagccgagatgtcccccaagatttccctgaccgatggcaccaatgcccgcaag
ccttccatgagcatcgcgccccagggccaggccccgcgcgtgcactttgccggcattccc
atgggtcatgaattcacctccctggtgctcgccctgctgcaaagcggcggtcacccctcc
aaggccgatccggccgtgctggagcaggtgaagaacctcaagggcgagttccacttcgag
acctatatttccctctcctgccacaactgtccggacgtggtacaggccctgaacctgatg
tccaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggatgag
gtgaacgagcgtcaaatcatggcggtcccgaacgtctacctgaacggtcagccgttcagc
cagggccgcatctcgctggaagagatcgttgccaaactcgacaccggcgctgccgagcgc
aaggcgcaagagctgagcgaaaaagcgccttatgacgtgctggtggtgggcggtggcccg
gccggtgccgccgcggccatctatgccgcccgcaaaggcattcgcaccgccattgtcgcc
gagcgtttcggtggccaggtgatggacaccgtcggcatcgagaacttcatctccgtgccc
tacaccgagggccccaagctggccgccagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgagcagcgtgccgccgccatcagcaaggatggttacgtcaacgtggac
ctcgcctccggtgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgcgacctgaacgtgccgggtgaactcgagtaccgtaccaagggtgtggcctactgcccc
cactgtgacggccccttcttcaagggcaagcgggttgcggtgatcgggggcggcaactcc
ggcatcgaggcggccatcgatctggctggcatcgtcgagcacgtcaccgtggtggagttc
gccgatactctgcgtgccgacgacgtgctgcagaagaaggcccgctccatgggcaacatt
gacatcatcatgagcgcccgcaccaccgaagtgatcggtgatggcagcaaggtggtgggc
atggattacgaagatcgcactaccggcgagatcaagcatctggcagtggccggcatcttc
gtccagataggcctggtgccgaacaccgagttcctcaaaggaagcgagattgccctgacc
cgctttggcgaaatcgagatcgataccaagggtgccacctccctgcccggcgtctatgcc
gcaggggatgccaccacggtaccgttcaagcagatcatcatctccatgggggcaggtgcc
accgccgccctgggtgcgtttgattacctcattcgcaacccatcgccggaagcacaagct
acccaggccgatgccgtgaccgcctga

DBGET integrated database retrieval system