KEGG   Aeromonas sp. ASNIH5: C2U30_02050Help
Entry
C2U30_02050       CDS       T05873                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aes  Aeromonas sp. ASNIH5
Pathway
aes00480  Glutathione metabolism
aes00590  Arachidonic acid metabolism
aes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aes00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C2U30_02050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2U30_02050
Enzymes [BR:aes01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C2U30_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AUT40607
UniProt: A0A2I8D019
LinkDB All DBs
Position
complement(482159..482635)
Genome map
AA seq 158 aa AA seqDB search
MPLPLIPLQRLDGTAWSTADLQGRVVLVVNVASRCGFTPQYTGLEALYRQFGPQGFEILG
FPCDQFGHQEPGDAEEIARFCSLDYPVSFPLMAKCEVNGAGAHPLYRWLKEQKPGLLGSE
AIKWNFTKFLIDREGRVVDRFAPQTRPEDLVQAIEGLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccctcatccccctgcaacgactcgatggcacggcctggtccaccgccgat
ctgcagggccgtgtcgtgctggtggtcaacgtggcaagccgctgcggttttaccccccaa
tacaccgggcttgaggccctctatcgccagttcggcccccaaggcttcgagatcctgggc
tttccctgcgatcagtttggccatcaggagccgggcgatgccgaggagatcgcccgcttc
tgctctctcgactaccctgtcagcttccccctgatggccaaatgcgaggtcaacggcgcc
ggggcccaccccctctatcgctggctcaaggaacaaaagcccggactccttggcagcgag
gccatcaagtggaacttcaccaagttcctgattgaccgtgaaggccgagtggtggaccgc
ttcgccccccagaccagaccggaggatctggtgcaggccatcgagggactgctctga

DBGET integrated database retrieval system