KEGG   Aeromonas sp. ASNIH5: C2U30_07130Help
Entry
C2U30_07130       CDS       T05873                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aes  Aeromonas sp. ASNIH5
Brite
Enzymes [BR:aes01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C2U30_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUT41506
UniProt: A0A2I8D2H4
LinkDB All DBs
Position
1594375..1594959
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGTLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaaccctggaataccaccatggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggtggcgtcttcaacaacgctgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgagcccactggcgccctggccgatgccatcaccaaggcc
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggc
tccagctggacctggctggtgaaaaaggctgacggcaccctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgaagccggtaccaccccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
gccctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system