KEGG   Aeromonas sp. ASNIH5: C2U30_07910Help
Entry
C2U30_07910       CDS       T05873                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
aes  Aeromonas sp. ASNIH5
Pathway
aes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aes01100  Metabolic pathways
aes01110  Biosynthesis of secondary metabolites
aes01130  Biosynthesis of antibiotics
aes01230  Biosynthesis of amino acids
Module
aes_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C2U30_07910
Enzymes [BR:aes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C2U30_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA_22 ABC_tran AAA_24 AAA_28 AAA Thymidylate_kin TsaE APS_kinase Ploopntkinase3 AAA_5 AAA_29 AAA_17 His_biosynth AAA_7 Guanylate_kin RsgA_GTPase AAA_PrkA IstB_IS21 RNA_helicase GTP_EFTU AAA_25 DUF2385
Motif
Other DBs
NCBI-ProteinID: AUT41644
UniProt: A0A2I8D466
LinkDB All DBs
Position
complement(1753181..1753699)
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRHLAEQLHMEFFDSDHEIERRSGADIGWVFDVEGEEGFR
IREEKVIGELAEQQGIVLATGGGAIKSRETRNKLSARGIVVYLETTIEKQLARTQRDKRR
PLLQTEEPPREVLERLAQERNALYEEVADFVIQTDDQSAKVVANQIVKLIGM
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttcctgataggtcccatgggtgcgggcaagagcaccata
ggtagacatctggcagaacaactgcacatggagtttttcgactcagatcatgagattgag
cgccgcagtggtgccgatatcggctgggtgttcgatgttgaaggcgaagaaggcttccgg
atccgcgaagagaaggtgatcggtgagctcgccgaacagcagggtatcgtgctggcaacg
ggtggcggtgccatcaagagccgtgaaacccgcaacaaactctccgcacgcggcatcgtg
gtctacctcgaaaccaccattgaaaagcaattggcgcgaacccagagagacaagcgtcgt
cccttgctgcaaaccgaagagccgccccgtgaagtgcttgagcgtcttgcgcaagagcgc
aacgccctgtacgaagaggttgccgattttgtcatccagacggatgaccagagtgccaaa
gttgtcgctaatcaaatcgtcaagttgattggtatgtaa

DBGET integrated database retrieval system