KEGG   Actinobacillus equuli: ACEE_03255Help
Entry
ACEE_03255        CDS       T03501                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
aeu  Actinobacillus equuli
Brite
KEGG Orthology (KO) [BR:aeu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aeu03016]
    ACEE_03255
Enzymes [BR:aeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     ACEE_03255
Transfer RNA biogenesis [BR:aeu03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    ACEE_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AIZ78806
UniProt: A0A0A7MJ95
LinkDB All DBs
Position
complement(681315..683291)
Genome map
AA seq 658 aa AA seqDB search
MFQDNPLLAQLKQQIEANKEYVEGTVKASDKAFGFLECDKKSYFIPPMEMKKVMHGDKVK
AVVKREGDKEQVEIDSLLEPMLDRFIAQVRFNKDNKLQLIVDHPSIKNIIPANTHKKVSE
TLENGDWVVAQLKTHPLRDDRFLFAQVTQFICKADDNFAPWWVTLARHEQPREPVANEKS
YELHDELDREDLTSLYFTTIDSPSTQDMDDALYIEPIKQGEEQTGWRLVVAIADPTAYIP
ENSNIEKAARQRCFTNYLPGFNIPMLPRELSDDLCSLVPNEKRPALVGYIETDLAGNIIG
GTRFVSAWVESKAKLAYDNVSDYLENVENAWQPDSAETKQQIDWLHQFTLARIEWRRSNA
LLFKESGDYSFELNEDGSVRDIHVEYRRIANQMIEESMIIANICCAKFLADNAKTGVFNT
HAGFDPKNLELAQKFLLDTLATDENREALTALYTPEKLATLEGYCEMRRSIDEFPEKFLE
LRLRRYLTFAEFKSEVAPHLGLGISHYATWTSPIRKYGDMVNHRLIKQVLLGKQAKAVEE
SILVRLQEARRQNRLVERDIADWLYARYLFPMVEQAVEFDCEIADVSRGGVRAKVIANGA
QIFVPFSTIHDKKEEMEFRPEEIALYIKGEKAYQIGQAVKVKLTEVRLETRSIVGNII
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagacaacccgttacttgcccaattaaaacaacaaattgaggcaaataaagaa
tatgtagaaggtacggttaaagcttcggataaagcattcggttttttagaatgtgacaag
aaaagttatttcattccaccgatggaaatgaaaaaagtgatgcacggcgataaagtgaaa
gccgtagtaaaacgtgaaggcgacaaagaacaggtagaaatcgatagtttacttgaaccg
atgcttgatcgctttattgcacaagtgcgttttaacaaagataataaattacaacttatt
gtcgatcacccaagcattaaaaatatcattccggcaaatacgcataaaaaggtcagtgag
acattggaaaacggtgactgggtagtggcgcaactcaaaactcacccgttacgtgatgat
cgtttcttatttgctcaagtcactcaatttatctgtaaagcggacgataatttcgcccca
tggtgggtcacattagctcgtcacgaacagcctcgtgaaccggtagcgaatgagaaaagc
tatgaattacacgatgaattagatcgtgaagatctcacttcactctatttcactacgatc
gacagtccaagcacacaagatatggacgatgcgctatacatcgagccaatcaaacaaggc
gaagaacaaaccggttggcgtttagtggtagcgattgccgatccgaccgcctatattcca
gaaaattcaaatatcgaaaaagccgctcgccaacgctgttttaccaactatttaccgggt
ttcaatattccgatgttacctcgtgagttgtcagacgatctctgttctctcgtaccaaat
gaaaaacgtccggcgttagtcggttatatcgaaaccgatttagctggtaatattattggc
ggtactcgttttgtttcagcatgggtggaaagcaaagcgaaattagcttacgacaacgta
tcggattacctcgaaaatgttgaaaatgcatggcaacctgatagtgcggaaaccaaacaa
caaattgattggttacaccaatttactcttgctcgcatcgaatggcgccgtagcaatgcg
ctgttatttaaagaatccggcgattactcatttgaattaaatgaagacggctcagtgcgt
gatatccacgtagaataccgccgtatcgcaaatcaaatgatcgaagaatcgatgatcatt
gccaatatttgctgtgcgaaattcttagccgataatgcaaaaacaggcgtatttaatacc
cacgccggctttgatccgaaaaatttagaattagcgcaaaaattcttactggatacgtta
gccactgacgaaaaccgtgaagcactgacggcattatatacgccggaaaaactggcaacg
cttgaaggttattgcgaaatgcgtcgttcaattgacgagtttccggagaaattcttagag
cttcgtttacgccgctacctcacttttgcagaatttaaatcggaagttgcaccgcatctc
ggtttagggatcagccattatgcaacttggacctcaccaattcgtaaatacggtgacatg
gtgaaccatcgcttaatcaagcaagtattacttggcaagcaggcgaaagcggtggaagaa
agcatcttagttcgcttacaagaagctcgccgtcaaaaccgtttggtggaacgtgatatc
gctgattggctttatgctcgctacctgtttccaatggtagagcaagcggtcgaatttgac
tgtgaaattgcggatgtttctcgtggcggtgtacgagcgaaagtcatcgcaaatggcgca
caaatttttgtgccgttctcaaccattcacgataaaaaagaagaaatggaattccgtccg
gaagaaatcgcactttacattaaaggcgaaaaagcttaccaaattggacaggcggttaaa
gtcaaactcaccgaagtacgtttagaaacacgttcgattgtgggaaacatcatctaa

DBGET integrated database retrieval system