KEGG   Aequorivita sp. H23M31: EI546_03815Help
Entry
EI546_03815       CDS       T05794                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aev  Aequorivita sp. H23M31
Pathway
aev03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aev00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EI546_03815 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aev03400]
    EI546_03815 (ligD)
Enzymes [BR:aev01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EI546_03815 (ligD)
DNA repair and recombination proteins [BR:aev03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EI546_03815 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme Spt20 DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: QAA80907
LinkDB All DBs
Position
856129..858840
Genome map
AA seq 903 aa AA seqDB search
MALDKYKKKRDPKITPEPFGGKSEKDVLRFVVQKHAASHLHYDFRLEMEGVLKSWAVPKG
PSTDPQVKRLAMMVEDHPYDYRNFEGIIPQGEYGGGTVIVWDEGTYEPADFDGKTKEEKD
KHLLKELESGKLKFILKGKKLKGEYALVKVHGRGENGWLLMKLKDKYALEEDITKKDKSV
ISKKTIDQVAETSTNILGQSKKKESKASTKKDKIPKEDSKNKDNEAKEDSTKEIDTILKK
AKKAKFPKSIKPMLATLVDEPFDDPDWSNEVKWDGYRSVAYIHNGDVNLSSRNNKSFSEK
YYPITAALEKWNKDAVLDGEIVVIGKDGKADFSALQNWRSEADGNLVYYVFDLLWFDGKN
IMDLPLNERQEVLKAILPTDDDHIHNSEAFITNGIEFFETAKEMKLEGIMAKRKNSRYSP
GNRSKDWLKVKANLRQEVVIGGYTKNEDSPKPFSSLLLGVYEKAKLQYVGKVGTGFTVKK
QKEMMEIFKPLVTSKSPFTTEPDVNQASRFRPDPPKAKATWLTPSLVCEVSFAEITKDGI
FRHPSFKGLRTDKKAKDVVRETASDTEAVVAEEKDDKPKKQKKIIKIPKAKKRQTLLNPT
EETQVKKINGHDLKFTNLSKVYWPEEGYTKRDMFNYYYQIAEYILPYLKDRPLSLYRFPN
GIHGKSFYQKDVKGKAPDWAITYPYTTSDGEDKEFLVGEKEDTLLWAASLGCIEMNPWFS
TIHTPDNPDYCVIDLDPAEKTSFDQVIEAAQEVKKVLDEMKVPGYAKTSGSTGIHIYIPL
DGNYTYDESQMFAKLIASIVQQRLPKFTSIERYTKNRDGKMYIDYLQNRPGATIAAPYSL
RPKVGATVSMPLHWEEIKKGLKMKDFDIKNSVARVREKGDIFRPILKKGINMEDALKNAS
KIS
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggctttagataaatacaaaaaaaagagagatccgaagataaccccagaaccgttcggc
gggaagagtgagaaggatgtattgcgttttgtagttcaaaaacacgccgcttcgcattta
cattatgacttccgattggaaatggaaggggtgctaaaaagctgggcagtgccgaaaggg
ccatctaccgatccgcaagtaaagcgccttgccatgatggtggaggaccatccctatgac
taccgcaactttgaaggtataattccgcagggagaatacggcgggggaacggtgatagta
tgggacgaaggcacctacgagcccgcggattttgacgggaagaccaaggaggaaaaagac
aagcatcttcttaaagagctggaaagcgggaagctgaagtttatacttaaaggcaaaaag
cttaaaggggaatacgcccttgtaaaagtccacggacggggagaaaatggttggctcctg
atgaaactgaaggataaatatgctttggaagaagatatcaccaaaaaagacaaatccgta
atctccaaaaaaaccatcgaccaggttgcggaaacgagtaccaatattctagggcaatcc
aagaaaaaggaatctaaagcttccactaaaaaagataaaatccccaaagaagattcaaaa
aataaagataatgaggcaaaagaggactcaacaaaggaaattgacactattctaaaaaaa
gccaagaaggccaaatttccaaaatccatcaagcctatgctggccaccttggtagatgaa
ccttttgacgatcctgattggagtaatgaagttaaatgggatggataccgctcggtggct
tatattcataatggggatgtaaatctatcttcaagaaataataaatccttttcggaaaaa
tattaccctatcaccgctgccctggaaaaatggaacaaggatgcggtcctagatggtgaa
atagtggttataggcaaagatggcaaggcggactttagtgccttacagaattggcgaagc
gaagccgatggcaatttggtgtattatgtttttgacctgttatggttcgatggcaaaaac
attatggatcttcccttgaacgagcgacaggaagttttaaaagctattttacctaccgat
gatgaccatatccataacagcgaagcctttattaccaatggtatagaattttttgaaact
gctaaggaaatgaagctggaaggcattatggccaaaagaaaaaacagtaggtattcccca
ggcaatcggtccaaggattggttaaaagtaaaagcgaatctaaggcaagaagtagtaata
ggaggatataccaaaaatgaagattcgcctaaaccttttagctcgctccttttgggagtt
tacgaaaaggcaaaactgcaatatgtgggtaaagtaggcacgggatttacggtgaaaaag
caaaaagagatgatggagatttttaagcctttggttacttccaaaagtccgtttaccacc
gaacccgatgtaaatcaggcttcccgatttagaccggacccacctaaggcaaaagccacc
tggcttaccccctctttggtatgtgaggtaagttttgccgaaatcaccaaagacggtatt
ttccgacatccatcctttaagggattgcgtacagacaaaaaggccaaggatgttgttcgg
gaaacggcatcggatactgaagctgttgtagccgaggaaaaggacgacaagccaaagaag
cagaaaaaaataatcaaaattcccaaagccaaaaaacggcagaccttactcaatcccacc
gaggagacccaggtcaagaaaataaacgggcacgatttaaaatttaccaacctcagtaag
gtttattggccagaagaaggatatacaaagcgggacatgttcaactattattatcagata
gccgaatatattctcccttatttaaaagaccggcctttgtccctttatcgttttccgaat
ggcatccatggaaaaagtttctatcaaaaagatgtaaaaggaaaggcgccggattgggcc
attacgtatccatatactaccagtgatggagaggacaaggaatttcttgtaggcgaaaag
gaggataccttattatgggctgcgtccttgggctgtattgaaatgaatccgtggtttagc
accattcacactcctgacaatcccgattattgtgtaatcgatcttgatcccgctgaaaaa
acttcctttgatcaagtaattgaagccgcgcaggaagtgaaaaaagtactggatgagatg
aaagttcccggctatgcgaaaacatctggttccacgggaattcatatttatattccactg
gatggaaactatacgtatgatgaatcccaaatgttcgcaaaattaattgccagcatcgtg
caacaaagactgccaaaattcaccagcattgaacgatataccaagaaccgcgacggaaaa
atgtatattgattatctccaaaaccgccctggggcaaccattgctgccccatactcatta
cggccaaaagtaggtgcaacagtctctatgccactgcattgggaagaaatcaaaaaagga
ctcaaaatgaaagattttgatataaaaaattccgtggcacgagtaagggaaaagggagat
atattccgccccatcttaaaaaaaggaatcaatatggaagatgcactgaaaaacgcatca
aagatttcatag

DBGET integrated database retrieval system