KEGG   Aequorivita sp. H23M31: EI546_14540Help
Entry
EI546_14540       CDS       T05794                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
aev  Aequorivita sp. H23M31
Pathway
aev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aev00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    EI546_14540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aev01004]
    EI546_14540
Enzymes [BR:aev01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     EI546_14540
Lipid biosynthesis proteins [BR:aev01004]
 Desaturase
  Front-end
   EI546_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase ABC2_membrane FAST_1
Motif
Other DBs
NCBI-ProteinID: QAA82861
UniProt: A0A410G6L5
LinkDB All DBs
Position
complement(3312938..3314038)
Genome map
AA seq 366 aa AA seqDB search
MTYTNLNFSRIDSAKFFRTLNKRVNDYFKENNISRTGNWKLHLKTIVMFSLYLTPYFLML
TLDLPGWLQLLFTIVMGVGMAGVGMNVMHDANHGSYSSKKWINKIMGGSMYILAGNVYNW
QVQHNVLHHTYTNIQGHDEDLEAGRILRFSQHSKWHRFHKFQHYYSIFLYGLLTFNWVLT
TDFFQTKRYLKRKLSYGEFPNPFKQWSILVITKIIYISLWIVIPILFFNIVWWKILIGFF
IMHYVAGLILSVVFQLAHVVGETDIMMPDESGTMKNTWAIHQLFTTTNFDTKNKIINWYT
GGLNHQVEHHIFPNICHIHYNNIAEILKSTTKEFNLPYKEYGTTRQAIIAHFRHLKEMGI
KPAITA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgacatatacaaatctcaatttttccagaatcgatagcgccaagttctttcgcacgcta
aacaagcgcgtcaacgattatttcaaggaaaacaatatttcccgaacagggaattggaaa
cttcaccttaaaactatcgtgatgttctctctttatcttaccccttactttttaatgttg
acattggatcttccgggatggctgcaattgctttttaccatcgtaatgggcgtaggcatg
gctggtgttggaatgaacgttatgcacgatgctaaccacggctcttattcctccaaaaaa
tggatcaataaaataatgggcggcagtatgtacattcttgccggaaatgtttacaactgg
caggtgcagcacaacgttcttcatcatacctataccaacatccaagggcatgacgaggat
ttggaagcgggacggatacttcggttttcacaacattcaaaatggcacagatttcataaa
tttcagcattattacagtatattcctttatgggttgctcacttttaattgggtgcttaca
accgactttttccaaacaaaaaggtatctgaaaagaaaactttcctatggagaattcccg
aatccttttaaacaatggagcatcttggtaataaccaaaatcatttacatctcactatgg
attgtaattcccatattatttttcaatattgtttggtggaaaattcttattggcttcttt
ataatgcactacgttgccggccttattttgagcgtagttttccagctcgctcacgtcgtg
ggagaaacggatattatgatgcccgatgaaagtggaactatgaaaaatacctgggctatc
catcaattgtttaccaccacaaacttcgacacaaaaaataaaataatcaattggtacact
gggggattaaaccaccaagtggagcatcatatttttccaaatatctgccatattcactat
aataatattgcggaaattttaaagagcactaccaaagaattcaatctaccttataaagaa
tacgggaccacccgccaggccatcatcgcccactttagacatctcaaggaaatgggaata
aagccggcaataacagcataa

DBGET integrated database retrieval system