KEGG   Asticcacaulis excentricus: Astex_0409Help
Entry
Astex_0409        CDS       T01378                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Astex_0409
Peptidases [BR:aex01002]
 Metallo Peptidases
  Family M2
   Astex_0409
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Astex_0409
CD molecules [BR:aex04090]
 Proteins
  Astex_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 DUF5491
Motif
Other DBs
NCBI-ProteinID: ADU12104
UniProt: E8RQ47
LinkDB All DBs
Position
1:425187..427082
Genome map
AA seq 631 aa AA seqDB search
MRRLLVSVAGPALVAGVLLSGCATVPAAAPIADVPTTEAPQAPALTETPAPAPAAAPTAA
DAKAYVEEAEKKLGDLGEYAARVQWVRATYITHDTMWLESKANAQLTEEGVKYAMGAAKF
NDVAVDEVTRRKLNLLRLSLVLPAADRPGAADEMAKLSTSLDSTYATGKFSYKGKVYTLD
DASNVMAESRDPALLRAMFEGWRTISVPMKGDYTRLAELANEGAKGLGFADTGALWRSGY
DMPPDGFAADTDRLWGQVEPFYKNLHCYVRSRLNEKYGDAVQPKSGPIRADLLGNMWAQD
WANIYDIVAPKGMKGSSYSLDKLLVQKKYTPEKMVRTGEGFYTSIGLPPLPQTFWERSMI
TRPRDREVLCHASAWDLDNRDDIRIKMCTQVNGEDFYTVHHELGHNYYQRAYKDQPFLFK
NGANDGFHEAIGDFIGLSSVTPVYLNQIGLLDKVPGEEEDIPYLLKMALQKVAFLPFGLM
VDRWRWEVYSGKITPAQYNTRWWELVQQYQGLVPPGVRPTDAFDPGAKYHVPGNVPYTRY
FLAHIYQFQFQQAACDQIGWKGPLHRCSIYGHKEVGQKLNAMLEMGQSKPWPEAMAAFTG
QREGDASAVAAYFKPLNEWLVKQNAGQNCGW
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtcttctggtttccgtagcaggtccggcgcttgtggccggtgtgttgttatca
ggctgcgcgacggtgcctgccgcggcccccattgctgatgtccccacaaccgaagcgcca
caggccccggccctgaccgagactcccgccccggcccccgctgccgctccgacagctgcc
gacgccaaggcctatgtggaagaggcggaaaagaagctcggcgaccttggcgaatacgct
gcccgcgtgcagtgggtgcgcgcgacctacatcacccacgacactatgtggctggaatcg
aaggccaatgcgcagctgaccgaagaaggcgtcaaatacgccatgggggccgcgaagttc
aacgacgtggccgtcgatgaggtaacgcggcgcaagctgaacctgctgcgcctgtctctg
gtcttgcccgccgccgaccgtccgggggctgccgatgagatggccaagctctccacttcg
ctagattccacctacgccacaggtaagttcagctataagggcaaggtctatactctggac
gacgcctcaaatgtgatggccgaatcccgcgacccggccctgcttcgcgccatgttcgaa
ggctggcgaaccatttcggtgccgatgaaaggtgactacacgcggctggccgaattggcc
aatgaaggcgctaagggtctgggctttgccgatacgggggccctgtggcgctccggctac
gacatgccgcctgatgggtttgcggccgatacggaccgcctctgggggcaggttgagccc
ttctacaagaacttgcactgctatgtgcgcagccgtctcaatgagaagtatggcgacgcg
gttcagccgaagtccggtcctatccgcgccgacctgctgggcaatatgtgggcgcaggac
tgggccaacatttatgacatcgtggcccctaagggcatgaagggctcgtcctattcgcta
gacaagctgctggtgcaaaagaagtatacgccggaaaagatggtcaggaccggcgaaggc
ttctacacttccattggtctgccgcctctgccccagaccttctgggagcgctcgatgatt
acccgcccgcgcgatcgcgaggttctgtgccacgcatcggcctgggacctcgataaccgc
gacgatatccgtattaagatgtgtacgcaggtcaatggcgaggacttttatacggtccac
cacgaactggggcataactattatcagcgcgcctataaggatcagcccttcctgttcaag
aacggcgccaatgatggcttccacgaagccatcggtgactttatcggcctgtcgtcggtg
acgccggtctatctcaaccagatcggtcttctggacaaggtgccaggcgaggaagaggac
atcccctacctgctgaaaatggccctgcaaaaggttgccttcctgccgtttggcctgatg
gtcgatcgctggcgctgggaagtctattccggcaagatcaccccggcacagtacaatacg
cgctggtgggagttggtgcagcagtatcagggccttgtgccaccgggcgtgcgtccgacc
gacgcctttgatccgggggccaagtatcacgtgccgggtaatgtaccctatacgcgctac
ttcctggcccatatctatcagtttcagttccagcaggccgcctgcgatcagatcggttgg
aaaggtccgctccaccgctgctcgatctatggccataaggaggtcggccagaagctaaac
gccatgctggagatgggtcagtcgaagccgtggccggaagccatggcggcctttacgggc
cagcgcgaaggcgatgcctcagcggtggcggcctatttcaagccgctcaatgagtggttg
gtcaagcaaaacgccgggcaaaactgcgggtggtga

DBGET integrated database retrieval system