KEGG   Asticcacaulis excentricus: Astex_0921Help
Entry
Astex_0921        CDS       T01378                                 

Definition
(GenBank) ABC transporter related protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
aex  Asticcacaulis excentricus
Pathway
aex02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aex00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Astex_0921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aex02000]
    Astex_0921
Transporters [BR:aex02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Astex_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 Tic110 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ADU12602
UniProt: E8RLB2
LinkDB All DBs
Position
1:complement(975493..977073)
Genome map
AA seq 526 aa AA seqDB search
MSAFKAYFADLKRRQRSSLIVASVCAAGVSIAATTLLGLSGWFLAGAAIAGAAGGAVMMA
FNYLLPSAAIRGLAIARTVMRYFERLSGHTAAFRALAELRPWLYERVSRTPLRVSQGEAS
ARLVQDVGQLENALVAQSHWASALGGLIAALFLITLLSPVASIIAAAGIGTLIGLSRRVV
PTPTTGLPELGALKNSMHETLPFLPDIAAYRLSERVMARLTEQEATLLAAREAQARTESL
PVGLNLGVLAATLSLIVLTHAHAAMPMLALGLLVTTVAFEATGPLLKAMAQKRLFAEAEA
RVAELGDVEAVPPAPRTGSVLRFGGQDYDLGPQARLLIRGASGSGKTRLIEALIGLRPME
EVPGLTALPDLRFSLSPQDAPTLNGTIGDNLLMALSPQEIAAETPESLTARVWAALEAAK
LKTRVAAMPKGLHQWIGDGGVTLSGGERKRLCLARALLRPAEVLVLDEPTEGLDAVTEAA
VTEAVEAHLKRNGQGLILVSHRSGPRRLCNQELVVDAAFQISRHVG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcattcaaagcatattttgcggatctgaagcgccgtcagcgctcgtccctgatc
gtcgcttcggtctgtgccgccggggtgtcgatcgcagcaaccaccctgcttggcctgtcg
ggctggtttctggccggcgcggccatagccggggccgcgggtggcgcggtgatgatggcc
ttcaactatctgctgccgtcggcggccatccgcgggctggctattgcacgcaccgtcatg
cgctatttcgagcgcctaagcggccatacggcggcctttcgtgctctggcagagctgcgc
ccgtggctgtatgaaagggttagccgtaccccgctacgcgtcagccaaggcgaggcctcg
gcgcggctggtgcaggatgtcgggcaactggaaaatgcattagtggcgcaaagccactgg
gcctcggcgctaggggggctgattgccgccctgttcctgatcacgctcctgtcgccggtg
gcctccatcattgcggcggcgggcatcggcacgcttataggcctgtcgcgtcgcgtcgtg
cctacgcccaccaccggcctgcccgaactgggggcgttgaaaaacagcatgcatgaaacc
ctgcccttcttgcccgacatcgccgcttatcggctgtcagagcgggttatggcgcggtta
acggagcaggaggccaccctgcttgcggcccgcgaggcccaggcgcggacagaaagcctg
cctgtggggttaaacctcggagtcttggccgcgacgctgagcctgatcgtcctcacccat
gcgcacgccgccatgccgatgctggcgcttggcttgctggtgacgacggtggcttttgaa
gcgaccggcccgctcttgaaagctatggcgcaaaaacgcctgttcgccgaggccgaggcg
cgggtggcggaactgggcgacgtggaggccgtgccacccgccccgcgcacggggtcagtt
ctgcgctttggcggccaggactacgacctcggtccgcaagcacgtctgctgatccgtggc
gcgtcgggatcgggcaagacgcgtctgatcgaggccctgatcggtctgcgcccgatggaa
gaggtgccggggctcaccgccctgcccgacctgcggttcagcctgtcgccgcaggacgcg
ccgacgctcaatggcaccatcggcgataatctcctgatggccctatcgccgcaggagatc
gcggcagaaacgccggaaagcctgacggcgcgggtgtgggccgcgttggaggccgcgaaa
ctgaaaacccgcgtggcggccatgcccaagggcctgcaccaatggatcggcgacggcggc
gtgaccctgtcgggcggggagcgcaaacgcctctgcctcgcccgtgccctgctgcgtcca
gccgaggtgctggtgctggatgagccgaccgaggggctggacgccgttaccgaagctgcc
gttaccgaggccgtcgaggcgcatcttaagcgcaacggtcagggcctgatcctcgtcagc
catcgttcgggccctcggcggctgtgtaatcaggaactcgtcgttgacgctgccttccaa
atctcccgccacgtcgggtag

DBGET integrated database retrieval system