KEGG   Asticcacaulis excentricus: Astex_1273Help
Entry
Astex_1273        CDS       T01378                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00473  D-Alanine metabolism
aex01100  Metabolic pathways
aex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Astex_1273
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Astex_1273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aex01011]
    Astex_1273
Enzymes [BR:aex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Astex_1273
Peptidoglycan biosynthesis and degradation proteins [BR:aex01011]
 Precursor biosynthesis
  Racemase
   Astex_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU12948
UniProt: E8RNQ2
LinkDB All DBs
Position
1:complement(1346699..1347829)
Genome map
AA seq 376 aa AA seqDB search
MDQALANEALTNGAGGILRVDLGALKANYLKLCQLAAPTPVSAVVKADAYGLGVKAVSAT
LHAVGCRHFFVALTREAFELRSHLPTDAALYVLNGLTPGSEARAAEARLIPVLDCPEQLD
AWAAVARQRGQTLPALLQVDTGMSRLGFMPEDLKALATAQERLQGLRIDYLMSHLACADE
PANPANGQQLEAFEMASRLFPDTPLCFANSGGLFLGAEYHADLCRPGIALYGAAPHLDRP
NPMQPVIALDLAVLQTRTVPAGTRIGYGGTVVTDAPKRLATLSAGYADGLPRRLGDQGAV
YFKGTRLPFIGRVSMDSIIIDIDALPEGTLKTGDFVELIGPHQSLDAVAEAAGTIAYEIL
TQLGPRYHRHLIVAEG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggctctggcgaatgaggctttgacaaacggcgcgggcggaattttgcgcgtc
gatcttggcgctctgaaagccaactatcttaaactgtgtcagttggcggcccctaccccg
gtcagcgccgtggtcaaggctgatgcctatggtctgggggtcaaggcggtgagcgccacg
ctgcacgccgtcggttgccgccatttcttcgtagccctgacgcgcgaagcgttcgaactc
cgctcgcatctgcccacagatgccgcgctctatgtgttgaacggactgacgcccggcagc
gaagcccgcgccgccgaagcccggctgatccctgtcctcgactgccccgaacagctcgac
gcctgggctgccgtagcgcgccagagggggcagaccctgcccgccctgttgcaggttgat
acgggcatgtcgcggctaggtttcatgcccgaagacctcaaggcgctggccaccgcacag
gagcgtcttcagggcttgcgtatcgactatctgatgagccatctggcctgtgccgatgag
cccgccaatccggccaatggccagcaactcgaagcctttgaaatggcctcgcgcctgttt
cccgatacacctttgtgctttgccaattccggtgggctattcctgggggcggaataccac
gccgatctgtgccgtcccggaattgccttgtacggggccgcgccacacctcgaccggccc
aatcccatgcagccggtcattgcgctcgatctggccgtccttcagacgcgcactgtcccc
gctgggacgcgcattgggtatggcggcacagtagtgaccgacgcgcccaaacgtctggcc
accctatcggccgggtatgcggacggtctgccacgtcggctgggggatcagggcgcggtc
tatttcaagggcacgcgtctgccgtttatcggccgcgtgtcgatggactctatcattatt
gacatagacgccctgcccgaaggcacgcttaagaccggcgattttgtcgaactgatcggc
ccgcatcagtcgctggacgctgtggccgaagcggcgggcaccatcgcttacgaaatcctg
acccaactgggtccgcgctatcaccgtcacctcatcgttgcggagggctga

DBGET integrated database retrieval system