KEGG   Asticcacaulis excentricus: Astex_1372Help
Entry
Astex_1372        CDS       T01378                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aex  Asticcacaulis excentricus
Pathway
aex03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aex00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Astex_1372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aex03400]
    Astex_1372
Enzymes [BR:aex01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Astex_1372
DNA repair and recombination proteins [BR:aex03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Astex_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S Caerin_1
Motif
Other DBs
NCBI-ProteinID: ADU13042
UniProt: E8RPE4
LinkDB All DBs
Position
1:1474686..1477229
Genome map
AA seq 847 aa AA seqDB search
MGLDLYNKKRDFAKTAEPEGKPGRKSGQRFLIQKHDARRLHYDFRLELDGVLKSWAVTRG
PSPNPQDKRLAVEVEDHPVAYGTFEGIIPKGQYGGGTVMMWDEGTWEPLDDPHKGLKAGS
LKFVLHGKRLSGEWALVRMKPRPKGPDRANWLLIKHDDAAARDDAAEAWLETQATSITTG
RRMEEIATNTQRVWTSRTRDEPPKRKQSKSMLEFIEPELATLAVAVPKGKDWVHEIKFDG
YRTQALIENGEVRLLTRTGLDWTHRFRPLPDYLAQMPVTSAILDGEIVAVDEGGRADFKT
LQATLAGEADVPLQFYVFDLLHSDGEDLRALPLVSRKARLQRLFNGNHFGGRVHYSEHFT
KDAADLKDRLCALDQEGLICKRANAPYHSGRNRAWLKVKCHKRQEFVIGGFTLPKAGSKG
IGALLIGYFQEGRLTYAGKVGTGFTLDSAIDLRRRLDLIAQKYHPFSDIPPEFKRGAHWV
APHLVAEVQFGEWTSDGRLRHPSFQGLREDKPPQDIHRDRPLSPTEVRKAEDVPAARKPK
RRAPASEKSPTDVVGGVAISSPDRVVFPGTDITKKDVAEYYLSVADHILPHIAGRPISTI
RCPQGIGGQCFFQRHLTQAAIPHVNDTGLPVNGREDDYIMITDAHGLISLMQWGVMEIHP
RGCMATTPNRPDRLIFDLDPDPEADWADVVAGAAEVRERMTEFDLQSFLKTTGGKGLHVV
IPIQPQYDWSAIKAFTRAVAESMTHDSPRRFVAQASKSKRKGRVFIDYLRNDFTATAVAP
YAVRARPGAPVAMPIDWKALSRDLDPAGFTLENTPAHLGRRKADPWADMARMNQRLSPKI
LKALNII
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcgacctatataacaaaaagcgcgactttgccaaaaccgccgagccggagggc
aagccgggacgtaagagcggccaacgcttcttgatccagaagcacgatgccaggcgcctg
cactatgatttccgacttgagctggacggggtgctgaaatcgtgggcggttactcgcggc
cccagcccaaacccgcaggacaagcgactggcggttgaggtggaggaccaccccgtcgcc
tacggaacctttgagggcatcattccaaagggccagtacggtggcgggacggtgatgatg
tgggacgaagggacttgggaaccattggacgacccgcataaggggctgaaggcgggcagt
ctcaaattcgtactccacggcaagcggctcagcggcgaatgggcactagtgcgcatgaag
ccacgaccaaaaggccctgatcgcgccaactggttgctgatcaaacacgatgatgcggcg
gcacgcgacgatgcggccgaggcgtggctggaaacccaggcgaccagcatcaccacggga
cgtcgaatggaggagatcgccacgaacacccaacgtgtttggacatcacgaaccagggac
gagccgccgaaacgcaagcagtccaaatcaatgcttgaatttatagagccggagttggca
accctcgccgtcgcggtccccaaaggtaaggactgggtgcatgagatcaagttcgatggt
taccgaacgcaggccctgatcgaaaatggcgaggtgcgacttctgacacgcacgggcctg
gactggacgcaccgctttcgtccactgcctgactatttggcgcagatgccggtcaccagc
gctatacttgatggtgagatcgtcgccgtggacgaggggggccgtgcggatttcaagacc
ctccaggccaccctggccggagaagccgatgtgccattgcaattttatgtcttcgatctt
ctgcacagcgacggcgaggacttgcgcgcccttccgctcgtgtcacgtaaggccagactg
caaaggctgtttaatggcaatcatttcggcggacgtgttcactacagcgaacattttacg
aaggatgccgctgatctgaaggaccggctctgcgcgttggatcaggaaggcctgatctgt
aaacgcgccaatgcgccttaccactcagggcgcaaccgtgcatggctgaaggtcaagtgc
cacaagcggcaggaattcgttatcggtgggttcaccctccccaaggccggcagtaagggg
attggggctttgctgatcggctattttcaggagggccgcctgacctatgccggtaaggtg
gggacgggttttactctcgacagcgccatcgacctgcgccgcagactggacctgatcgct
caaaaatatcatccgttcagtgatattccgccagaatttaaacgcggggcgcattgggtc
gcgccgcaccttgtcgccgaggtgcagttcggcgaatggacttcagatggccgcttgcgc
cacccctcgtttcaaggcctgcgtgaagacaagccgccgcaggacatccaccgcgaccgc
ccactcagcccaactgaagtgcgcaaagccgaggacgtacctgcggctcgcaagcccaag
cgccgggcccccgcatcagaaaaatccccgacagacgtggtcggtggggtcgcgatctcg
tcgccagaccgcgtcgtttttcccggcacggatatcaccaagaaggacgtggctgagtat
tatctcagcgtcgccgaccatatcctgccgcacattgccgggcgtcccatctcaacgatc
cgctgcccacaaggcattggcggacaatgttttttccaacgccacctcacccaggccgcc
atcccgcacgtcaacgataccggtcttccggtcaatggccgcgaagacgattacataatg
attacggacgctcacggcctgatcagcctgatgcaatggggcgtgatggagatacacccc
cggggctgcatggccaccacgcccaaccgtcccgaccgcctgatcttcgatctcgacccc
gatccggaagcggactgggccgacgtggtggccggggcggctgaggtgcgcgagcgtatg
accgagttcgacctccagagtttcctcaaaaccacgggtggcaagggattgcacgtggtc
atccctattcaaccccagtacgactggagcgccatcaaagcctttacgcgtgccgtggcg
gaatccatgacgcacgacagcccgagacgctttgtggcgcaagcatcaaaatccaagcgc
aaaggccgagtctttatcgattacctgcgcaatgacttcaccgccaccgccgtggctccc
tatgctgtccgcgcgcgtcccggtgcgcccgtggcgatgccgatagattggaaggcactc
agccgcgacctcgatccggcaggtttcaccttggagaacacacctgctcatctcggacgg
cgcaaggccgatccgtgggcagatatggctcgaatgaatcagcgcctgtcgccaaaaata
cttaaggcgttgaatattatttaa

DBGET integrated database retrieval system