KEGG   Asticcacaulis excentricus: Astex_1859
Entry
Astex_1859        CDS       T01378                                 

Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00270  Cysteine and methionine metabolism
aex00450  Selenocompound metabolism
aex00670  One carbon pool by folate
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01230  Biosynthesis of amino acids
Module
aex_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Astex_1859
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Astex_1859
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Astex_1859
Enzymes [BR:aex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Astex_1859
SSDB
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding CdhD
Other DBs
NCBI-ProteinID: ADU13522
UniProt: E8RRZ7
LinkDB
Position
1:complement(1981434..1984091)
AA seq 885 aa
MTTIMTPTFINIGERTNVTGSAKFRKLIVEGNYTAALDVARQQVEAGAQIIDINMDEGLL
DAVKAMTTFLNLLAAEPDIARVPVMIDSSKWEVIEAGLKCVQGKAIVNSISMKEGEDIFR
HHARECLKYGAAVVVMAFDEVGQADTAARKIDICTRAYNILVNEVGFPPEDIIFDPNIFA
VATGIEEHDNYAVDFIEATRTIKQTLPFARISGGVSNVSFSFRGNEPVRRAIHSVFLYHA
IKAGMDMGIVNAGDLPVYDDIDAELREAVEDVILNRPQRHNVSNTEWLVDLAPKYKGEKG
QVEAKTLAWREGTVEERLKHALVHGITEFIEADTEEARQKAERPLHVIEGPLMAGMNVVG
DLFGAGKMFLPQVVKSARVMKQSVAYLMPFMEAEKDGAEHQSAGKILMATVKGDVHDIGK
NIVGVVLQCNNYEVVDLGVMVPADRILEEAKKHKVDMIGLSGLITPSLDEMVFVAREMQR
QGFDIPLLIGGATTSKTHTAVKIEPGYSNGQTVYVLDASRAVGVVSQLLSDSDKAQFIAD
TRADYEKVRLAYGKGDQKPRSDLTEARSKKFVIDFASEAPLAPTFLGTRTFSPYDLHDLA
DHIDWTPFFATWELAGRFPDILEDEIVGEAATTLYADARAMLKRILDEKWFEARGVVGFW
PANATEDDDIEVYEDETRSKVIARFHTLRQQMKKTRDDQSNTALSDFIAPKGTPDWIGGF
AVTAGHGEMEIAAKFKAAGDDYNAILATALADRLAEAFAEALHKRVRRELWAYAADEDLD
VAGLIAEQYKGIRPAPGYPAQPDHTEKWTLFDLLDARVQAGMQLTESLAMTPPASVSGLY
FAHPKSHYFGVGKIEKDQVEDYARRKGWSVDEAERWLSPILNYVP
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgaccacgattatgacccccaccttcatcaatatcggcgaacgcaccaatgtcacgggc
tcggcgaagttccgtaagctgatcgtcgaaggcaattacaccgccgcgctcgatgtggcg
cgtcagcaggtggaggccggggcgcaaattatcgacatcaatatggacgaaggcctcctt
gatgcggtcaaggccatgacgactttcctcaacttgctggcggccgaacccgatatcgcc
cgcgtgccggtgatgatcgactcgtcgaaatgggaggtgatcgaggcgggtctgaagtgc
gttcagggcaaggctatcgtcaactccatctcgatgaaagaaggtgaggatatcttccgc
catcacgcccgcgaatgtctaaaatatggggcggcggtagtggtcatggcctttgacgag
gtggggcaggctgacaccgcggcgcgcaagatcgacatctgtacgcgcgcctacaacatc
cttgtcaacgaggtgggcttcccgccagaagacatcatcttcgaccccaatatcttcgca
gtggcgactgggatcgaggaacacgacaactacgccgtggactttatcgaagcgacgcgc
acgatcaagcagacactgccctttgcgcgcatatcgggtggcgtgtcgaacgtcagcttc
tccttccgtggcaatgagccggtgcgccgcgctatccactcggtgttcctgtatcatgcc
atcaaggccggcatggatatgggcatcgtcaatgccggtgacctgcccgtctatgacgat
atcgacgcggagctgcgcgaagcggtcgaggatgtgatcctgaatcgcccgcaacgccat
aatgtgtcgaataccgaatggctggtcgatctggcccccaaatacaagggggaaaagggg
caggtcgaggcgaagacgctggcctggcgcgaaggcactgtcgaagaacggctcaaacac
gcgctggtgcacggcatcaccgaatttatcgaagccgataccgaagaggcgcggcaaaag
gctgagcgtcctctgcatgttatcgaaggcccgctgatggccgggatgaacgtcgtcgga
gacctgtttggggcgggcaagatgttcctgccacaggtggtcaaatccgcccgtgtcatg
aagcagtcggttgcctatctgatgcccttcatggaggctgaaaaagatggcgcagagcac
cagtcggccggcaagattctgatggccacggtcaagggcgacgtgcacgacatcggcaaa
aatatcgtcggcgtggtcttgcaatgtaacaattatgaggtggtcgatctgggggtgatg
gtgccagccgatcgcatccttgaggaagccaaaaagcataaggttgatatgatcggcctc
tcaggcctgatcacgccgtctttggatgaaatggtgtttgtagcgcgcgaaatgcagcgt
cagggctttgacattccgttgctgattggcggggcgacgacctctaaaacccacactgcg
gtgaagattgagcctggctatagcaacggccagaccgtttacgtgctcgatgcctcgcgt
gccgtaggcgttgtgtcgcaactgctgtccgacagcgacaaggcgcagttcatcgccgat
acgcgcgccgactatgagaaggtgcgtctggcctatggcaagggcgatcagaagccgcgc
tccgacctgacggaagcgcgttcaaagaagttcgtcatcgactttgcgtccgaagcgccc
ttagctccgaccttcctcggtacgcgcaccttcagcccctatgacctacacgatctggcc
gaccatatcgactggacgccgttttttgccacctgggagctggccgggcgcttcccggac
atccttgaggacgagattgtgggcgaggcagccaccaccctctatgctgacgctagggct
atgctgaaacgcattctggacgaaaaatggtttgaggcgcgcggcgtcgtcggcttctgg
cccgccaatgccactgaagacgacgatattgaagtctatgaagacgagacgcgctcaaag
gttattgcgcgtttccacaccctgcgacaacagatgaagaagacgcgcgacgatcagtca
aacaccgctctgtcggactttatcgctcctaagggcacgccagactggatcggcggcttc
gccgtcaccgctgggcatggcgaaatggagatcgcagcgaagttcaaggcggcgggtgat
gattacaacgcgattctggccaccgctttggcggaccgtctggccgaagcctttgccgaa
gccctgcacaagcgcgtgcggcgcgaactttgggcctatgcagcagacgaagaccttgat
gtcgccggtctgatcgccgagcagtataagggcattcgcccggcgcccggctatccggcg
cagcccgaccacaccgaaaaatggacactgttcgatctcctggatgcgcgggtccaggcg
gggatgcaactgaccgaaagcctggccatgacgccgccggcctcggtatcaggcctttat
ttcgcgcatccaaaatcgcactatttcggtgtcggcaagattgaaaaggatcaggtcgaa
gactatgcccgccgcaagggctggagcgttgatgaggcggagcggtggttgagcccgatc
ctgaattacgtgccgtaa

DBGET integrated database retrieval system