KEGG   Asticcacaulis excentricus: Astex_1955Help
Entry
Astex_1955        CDS       T01378                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00620  Pyruvate metabolism
aex00680  Methane metabolism
aex01100  Metabolic pathways
aex01120  Microbial metabolism in diverse environments
aex01200  Carbon metabolism
Module
aex_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Astex_1955
  Energy metabolism
   00680 Methane metabolism
    Astex_1955
Enzymes [BR:aex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Astex_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADU13618
UniProt: E8RL05
LinkDB All DBs
Position
1:complement(2096482..2099154)
Genome map
AA seq 890 aa AA seqDB search
MTDAMIDHVKQNTAMLEGFLTDAVNSFGRGTVLSKIEALRADNADVDDLSESEAAHAARV
LTCLSTLTVLSEDVANLKRVETFPGTQEAITLANAVQQARAKGHSQAEIEETLNGILASP
VFTAHPTEMRRASVVEREYDITQFLSAYERTTRASERKALEEDLFRAVALLFNTRLNRPE
RITVADEIQNSLGAVRRAILPALVELYGDWNREIELEGELPNVLKLGSWIGGDRDGHPHV
DDTTMNYAFHNQAKLVLDFYFQQLDKLDIELTLSEELAPVTDALLELARKSSDTNVHRVD
EPYRRALTFIKTRLASTWQAILKLPHPLASPLAGAYETSENFVRDLLIIRDSLIEYGGKR
LVGRTLKSTIQIARSCGFHLLSLDMRQNSAVHERVIAELFAQSSELLDYSSLSENERVSA
LVAELTNDRLLRWPFAKYSDETRRELRIIDAAAEVIRTFGPDAIGAYVVSMAKSVSDILE
PLVLLKQAGLVYGGPSPHTMIRVSPLFETIEDLEAAPDIMKRWLGLPAMRSLMGRPAVQE
VMLGYSDSNKDGGYTASRWSLHKASSAIKAVCNQKGVALRLFHGRGGSVGRGGGPSFNAI
MAQPEGTVGGQIRVTEQGEMIARKFGNKTTAGKTLDSFSAAVFLASLPVKERDAHHIKES
EAEAKYGPLMNQLCKASFDAYRALVYDDPHFLDFFRSVTPISEISDLKIGSRPASRTKSG
KIEDLRAIPWVFSWSQSRMVLPGFYGFNAAVKALGVDDQTLIDMCNEWDFFEVFLANMEM
ALAKSDMEMASLYAGMASDPVEAQRIFATIRQEHEEMTALAKRIRKAGTLLSTHEQLRGS
IERSHALLQTLNRMQVKLLKKRREGNKHKLVKLAMQLTVNGIASALRNTG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctatgatcgatcacgtgaagcagaacaccgccatgttggaggggtttctg
actgatgccgtcaacagtttcgggcgcggcactgtgttgtcgaagatcgaggcgctgcgt
gccgacaacgccgatgtcgatgatttaagcgaatctgaggccgcccacgcggcgcgcgtc
ctgacctgcctgtccaccctgaccgtcctgtccgaggacgtggccaatctcaagcgcgtc
gagacatttccggggacgcaggaggccatcactttggctaatgccgtgcagcaggcgcgc
gccaaggggcactcgcaggccgagatcgaagaaacgctcaacggcattctggcctcgcct
gtgtttacggcgcacccgacagaaatgcgccgtgcctcggtggtggagcgcgaatacgac
attacccaattcctgtcggcctatgagcgcacgacccgcgcctcggagcgcaaggcgctg
gaagaggaccttttccgcgcggtggcgctgctcttcaatacgcgcctcaaccgcccggag
cgcatcacagtcgccgatgagattcaaaactctctaggggccgtgcgtcgcgccatcctg
ccggcgctggtagagctttatggcgactggaaccgcgagatcgagctggaaggcgaactg
cccaacgtgctgaaactcggctcgtggatcggcggcgaccgcgacggccacccgcacgtc
gatgacaccaccatgaactacgccttccacaatcaggcgaagctggtactcgacttctat
ttccagcagttggacaagctcgatatcgaactgaccctgtctgaagaactggcgccggtt
actgatgcgctactggagctggcgcgcaaatcgtccgataccaatgtgcaccgcgtcgac
gagccctatcgtcgcgctctcacgtttatcaagacgcggctggcttcgacctggcaggcc
attctcaaactgccgcatccgctggcgtcgccgttggccggtgcctatgagacatcggaa
aactttgtgcgcgatctgctgatcatccgcgattcgctaatcgaatatggcggcaagcgg
ctggtagggcggacgctgaaaagcaccatccagattgcccgttcgtgcggcttccacctg
ttgtcgctagacatgcggcaaaactccgcggtgcatgagcgcgtgattgccgaactgttc
gcccagtcgtcggaactacttgactacagctcgctgtcggaaaacgagcgcgtgtcggcg
ttggtggcggagctgacaaacgaccggctgctgcgctggccttttgccaaatactccgat
gagacgcgccgcgaactgcgcatcattgacgcggcggccgaagtcatccgcacctttggg
ccggacgccatcggagcctatgtggtgtcgatggccaagtcggtgtcggacatccttgag
ccgctggtgctgctgaaacaggctggtttggtctatggcgggccgtcgccacacaccatg
atccgcgtgtcgcctttgtttgaaaccatcgaagaccttgaggccgcacccgacatcatg
aagcgctggctggggctgccggcgatgcgctcgctaatggggcgtccggcggtgcaggag
gtcatgctcggctattcggactccaacaaggatggcggatatacggcctcgcgctggagc
ctgcacaaggcctcgtctgccatcaaggctgtatgcaatcagaagggcgtggcgctgcgt
ctgttccacggtcgcggcggttcggtcggtcgtggcggcggcccgtccttcaatgccatc
atggctcagcccgaaggcacggtcggcggtcagatccgcgtcaccgaacagggcgaaatg
attgcacgtaagttcggcaacaaaacaacggccggcaagacactcgattccttctcggcg
gcggtcttcctcgcctccctgccggtcaaggagcgcgacgcgcatcacatcaaagagtcc
gaggccgaagcgaagtatggcccgcttatgaatcagttgtgcaaggcctcattcgacgcc
tatcgtgccctggtctatgacgatcctcacttcctcgatttcttccgctccgttacgccg
atctcggagatttccgacctcaagatcggctcgcgcccggcttcgcgcaccaaatcgggc
aagatcgaagaccttcgcgccattccgtgggtcttttcatggtcgcagtcgcgcatggtc
ctgccggggttctatggtttcaacgcggcggtcaaggcgctgggggtcgatgaccaaact
ctgatcgacatgtgcaacgaatgggacttcttcgaggtgttcctggccaatatggagatg
gcactggccaagtcggatatggagatggcgtcgctttacgccggaatggcctccgatccg
gtcgaggcgcagcgcatcttcgccactatccgtcaggagcacgaggagatgactgcgctg
gccaaacgcatccgcaaggcgggcacgcttctgtctacccatgagcagttgcgcggctct
attgaacgctcgcacgccctgcttcagacgctcaaccgcatgcaagtcaagcttttgaaa
aagcgccgcgaaggcaacaagcacaagttggttaagctggccatgcaattgacggtcaac
ggcatcgcctcggccctgcgcaataccgggtag

DBGET integrated database retrieval system