KEGG   Asticcacaulis excentricus: Astex_2919Help
Entry
Astex_2919        CDS       T01378                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00010  Glycolysis / Gluconeogenesis
aex00020  Citrate cycle (TCA cycle)
aex00620  Pyruvate metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
Module
aex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_2919
   00020 Citrate cycle (TCA cycle)
    Astex_2919
   00620 Pyruvate metabolism
    Astex_2919
Enzymes [BR:aex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Astex_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C DUF2118 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ADU14556
UniProt: E8RST5
LinkDB All DBs
Position
2:complement(606457..607728)
Genome map
AA seq 423 aa AA seqDB search
MTDILMPALSPTMEEGILAKWHVKVGDTVSAGDVIAEIETDKATMEVEAVDEGVVEAILI
EAGTEGVKVNTPIARLAGEGGSAAPAPKAEAPKAAEAPKPAAAPAPVVAAPVAAPAVSGG
ARVAASPLARRLAEINKLDLKLLKGTGPHGRIIKRDIEAALASGTGKAGSAPAATTAAAE
PRKVQSLEQMGIAPGSYDLVPLNNMRKVIARRLTESFRDIPHFPLTVDIELDNLLAARTK
INTALESQGIKVSVNDIVIKAVALALKQVPEANASFTPEGIAMHHNADIAMAVAIDGGLI
TPIIRKAETKSLAQIAKETKDLAARARDMKLKPEEFQGGTFSVSNLGMFGIKQFASIINE
PQGCILSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVVDGSVGAKYITALKGLLEDPIK
MLA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattctgatgccggcgctctcgcccaccatggaagagggcattctggccaag
tggcacgtcaaggtcggggacaccgtctccgccggtgacgtcatcgccgaaatcgaaacc
gacaaggcgacgatggaagtcgaagccgtcgatgaaggcgtggtagaggccatcctcatc
gaagccgggaccgaaggcgtgaaggtgaacacccctatcgcccgtttggcgggtgagggt
ggttctgccgcccccgcacccaaggctgaggccccgaaagccgccgaagccccgaagccc
gcggcggctccggcccccgtggtcgcagcgcctgtcgcggctccggccgtttcgggtggg
gcgcgcgtggcggcttcgccgctggcgcgtcgtctggccgagatcaacaagctcgacctc
aagctgctgaagggcaccggcccgcacggccgtatcatcaagcgcgatatcgaagccgct
ctggcttcgggcaccggcaaggccggttccgccccggcggcgaccaccgctgcggctgag
ccgcgcaaggttcaaagcctagagcaaatgggcattgcaccgggttcttacgacctcgtg
ccgctcaacaatatgcgcaaggtcatcgcccgtcgcctgaccgaatccttccgcgacatc
ccgcacttcccgctgaccgtcgatatcgaactcgacaacctgctggcggcgcgcaccaag
atcaatacggcgctggaatcgcagggcatcaaggtctcggtgaacgatatcgtcatcaag
gcggtggcgctggcgctcaagcaggtgccggaagccaatgcctccttcacccccgaaggc
attgcgatgcaccacaatgcggatatcgccatggctgtggccatcgacggcggcctgatc
accccgatcatccgtaaggccgaaaccaagtctctggcccagatcgccaaggaaaccaag
gatctggcggcgcgcgcccgcgatatgaagctgaagcccgaagagttccagggcggcacc
ttctcggtgtcaaacctcggcatgttcggtatcaagcagttcgcttcgatcatcaacgaa
ccgcagggctgcatcctgtcggtcggtgctggtgagcagcgcccggtcgtcaagaacggc
caactggcggtcgctaccgtcatgaccgtcaccctgacatgtgatcaccgcgtggtcgat
ggctcggtcggtgccaagtacattaccgcattgaagggccttctcgaagacccgattaaa
atgttggcttaa

DBGET integrated database retrieval system