KEGG   Asticcacaulis excentricus: Astex_3255Help
Entry
Astex_3255        CDS       T01378                                 

Definition
(GenBank) mutator MutT protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
aex  Asticcacaulis excentricus
Brite
KEGG Orthology (KO) [BR:aex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aex03400]
    Astex_3255
Enzymes [BR:aex01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Astex_3255
DNA repair and recombination proteins [BR:aex03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Astex_3255
 Prokaryotic Type
    Astex_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 Ribosomal_L12_N NUDIX_2
Motif
Other DBs
NCBI-ProteinID: ADU14889
UniProt: E8RTR8
LinkDB All DBs
Position
2:complement(979048..979446)
Genome map
AA seq 132 aa AA seqDB search
MKTVLVVAAALIDSDGRVLIAQRPEGKSLAGQWEFPGGKVEAGETPEAALIRELEEELGI
TTRAACLAPFVFASHTYEMFHLLMPLYLIRRWEGTPQPKEHTALKWVRPKDMRDYPMPPA
DLPLVAYLNDLI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtacttgtcgttgcggcggccctgatcgacagtgacggccgtgtgctgatc
gctcagcgcccggaaggcaagtctctggctgggcagtgggagtttcccggcggcaaggtc
gaagccggcgaaacccccgaagcggcgctgatccgtgagcttgaggaagaactgggtatt
acgaccagggccgcctgtctggctcccttcgtctttgcttcgcacacctatgagatgttt
cacctgctaatgccactctacctgatccgccgctgggagggcacgccgcaaccgaaggaa
cacacagcgctgaaatgggtacggcccaaagacatgcgcgactatcccatgcccccggca
gacctgccgttggtggcgtatctcaatgatttgatttaa

DBGET integrated database retrieval system